• Gene id: 79657

Gene Summary

• Gene Symbol: RPAP3   Gene   UCSC   Ensembl
• Aliases: Tah1, hSpagh
• Gene name: RNA polymerase II associated protein 3
• Alternate names: RNA polymerase II-associated protein 3,
• Gene location: 12q13.11 (47706060: 47661248)     Exons: 17     NC_000012.12
• Gene summary(Entrez): This gene encodes an RNA polymerase II-associated protein. The encoded protein may function in transcriptional regulation and may also regulate apoptosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]
• OMIM: 606362

Protein Summary

• Protein general information: Q9H6T3  
  • Name: RNA polymerase II associated protein 3
  • Length: 665  
  • Mass: 75719
• Sequence:

  MTSANKAIELQLQVKQNAEELQDFMRDLENWEKDIKQKDMELRRQNGVPEENLPPIRNGNFRKKKKGKAKESSKK
  TREENTKNRIKSYDYEAWAKLDVDRILDELDKDDSTHESLSQESESEEDGIHVDSQKALVLKEKGNKYFKQGKYD
  EAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYE
  RVLELEPNNFEATNELRKISQALASKENSYPKEADIVIKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYER
  AIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFET
  VLLLEPGNKQAVTELSKIKKELIEKGHWDDVFLDSTQRQNVVKPIDNPPHPGSTKPLKKVIIEETGNLIQTIDVP
  DSTTAAAPENNPINLANVIAATGTTSKKNSSQDDLFPTSDTPRAKVLKIEEVSDTSSLQPQASLKQDVCQSYSEK
  MPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHD
  FYIEKEKPLLIFEILQRLSELKRFDMAVMFMSETEKKIARALFNHIDKSGLKDSSVEELKKRYGG

• Structural information:
  • Interpro: IPR025986  IPR013026  IPR011990  IPR001440  IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 4CGV 4CGW 6EZ4 6FD7 6FDP 6FDT 6FM8 6FO1 6GXZ
  • PDBsum: 4CGV 4CGW 6EZ4 6FD7 6FDP 6FDT 6FM8 6FO1 6GXZ
  • DIP: 47508
  • STRING: ENSP00000005386
• Other Databases: GeneCards:  RPAP3  Malacards:  RPAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0097255	R2TP complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq