• Gene id: 79647

Gene Summary

• Gene Symbol: AKIRIN1   Gene   UCSC   Ensembl
• Aliases: C1orf108, STRF2
• Gene name: akirin 1
• Alternate names: akirin-1,
• Gene location: 1p34.3 (38991243: 39006064)     Exons: 5     NC_000001.11
• OMIM: 615164

Protein Summary

• Protein general information: Q9H9L7  
  • Name: Akirin 1
  • Length: 192  
  • Mass: 21867
  • Tissue specificity: Widely expressed with the highest expression in heart, liver, placenta and peripheral blood leukocytes. {ECO
• Sequence:

  MACGATLKRPMEFEAALLSPGSPKRRRCAPLPGPTPGLRPPDAEPPPPFQTQTPPQSLQQPAPPGSERRLPTPEQ
  IFQNIKQEYSRYQRWRHLEVVLNQSEACASESQPHSSALTAPSSPGSSWMKKDQPTFTLRQVGIICERLLKDYED
  KIREEYEQILNTKLAEQYESFVKFTHDQIMRRYGTRPTSYVS

• Structural information:
  • Interpro: IPR024132  
  • STRING: ENSP00000392678
• Other Databases: GeneCards:  AKIRIN1  Malacards:  AKIRIN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0010759	positive regulation of macrophage chemotaxis	ISS	biological process
GO:1902725	negative regulation of satellite cell differentiation	ISS	biological process
GO:0014839	myoblast migration involved in skeletal muscle regeneration	ISS	biological process
GO:0010592	positive regulation of lamellipodium assembly	ISS	biological process
GO:1902723	negative regulation of skeletal muscle satellite cell proliferation	ISS	biological process
GO:0045663	positive regulation of myoblast differentiation	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:1902725	negative regulation of satellite cell differentiation	IEA	biological process
GO:0010759	positive regulation of macrophage chemotaxis	IEA	biological process
GO:1902723	negative regulation of skeletal muscle satellite cell proliferation	IEA	biological process
GO:0045663	positive regulation of myoblast differentiation	IEA	biological process
GO:0014839	myoblast migration involved in skeletal muscle regeneration	IEA	biological process
GO:0010592	positive regulation of lamellipodium assembly	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R