• Gene id: 79625

Gene Summary

• Gene Symbol: NDNF   Gene   UCSC   Ensembl
• Aliases: C4orf31, HH25, NORD
• Gene name: neuron derived neurotrophic factor
• Alternate names: protein NDNF, fibronectin type-III domain-containing protein C4orf31,
• Gene location: 4q27 (121072534: 121029292)     Exons: 5     NC_000004.12
• OMIM: 114350

Protein Summary

• Protein general information: Q8TB73  
  • Name: Protein NDNF (Neuron derived neurotrophic factor)
  • Length: 568  
  • Mass: 64673
• Sequence:

  MVLLHWCLLWLLFPLSSRTQKLPTRDEELFQMQIRDKAFFHDSSVIPDGAEISSYLFRDTPKRYFFVVEEDNTPL
  SVTVTPCDAPLEWKLSLQELPEDRSGEGSGDLEPLEQQKQQIINEEGTELFSYKGNDVEYFISSSSPSGLYQLDL
  LSTEKDTHFKVYATTTPESDQPYPELPYDPRVDVTSLGRTTVTLAWKPSPTASLLKQPIQYCVVINKEHNFKSLC
  AVEAKLSADDAFMMAPKPGLDFSPFDFAHFGFPSDNSGKERSFQAKPSPKLGRHVYSRPKVDIQKICIGNKNIFT
  VSDLKPDTQYYFDVFVVNINSNMSTAYVGTFARTKEEAKQKTVELKDGKITDVFVKRKGAKFLRFAPVSSHQKVT
  FFIHSCLDAVQIQVRRDGKLLLSQNVEGIQQFQLRGKPKAKYLVRLKGNKKGASMLKILATTRPTKQSFPSLPED
  TRIKAFDKLRTCSSATVAWLGTQERNKFCIYKKEVDDNYNEDQKKREQNQCLGPDIRKKSEKVLCKYFHSQNLQK
  AVTTETIKGLQPGKSYLLDVYVIGHGGHSVKYQSKVVKTRKFC

• Structural information:
  • Protein Domains: (261..33-)
    1 (/note="Fibronectin-type-III)
    (445..56-)
    2" (/note="Fibronectin-type-III)
  • Interpro: IPR003961  IPR036116  IPR019326  
  • STRING: ENSP00000369014
• Other Databases: GeneCards:  NDNF  Malacards:  NDNF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	IBA	biological process
GO:0030198	extracellular matrix organization	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0001525	angiogenesis	IDA	biological process
GO:0071456	cellular response to hypoxia	IDA	biological process
GO:2000352	negative regulation of endothelial cell apoptotic process	IDA	biological process
GO:0007263	nitric oxide mediated signal transduction	IDA	biological process
GO:0061042	vascular wound healing	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0061042	vascular wound healing	IEA	biological process
GO:0030198	extracellular matrix organization	IEA	biological process
GO:0008201	heparin binding	IEA	molecular function
GO:0005539	glycosaminoglycan binding	IEA	molecular function
GO:0031012	extracellular matrix	IEA	cellular component
GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	IEA	biological process
GO:0010811	positive regulation of cell-substrate adhesion	IEA	biological process
GO:0002931	response to ischemia	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0043524	negative regulation of neuron apoptotic process	IDA	biological process
GO:0010976	positive regulation of neuron projection development	IDA	biological process
GO:0005576	extracellular region	IDA	cellular component
GO:0001764	neuron migration	IDA	biological process
GO:0030198	extracellular matrix organization	ISS	biological process
GO:0008201	heparin binding	ISS	molecular function
GO:0005539	glycosaminoglycan binding	ISS	molecular function
GO:0031012	extracellular matrix	ISS	cellular component
GO:0019800	peptide cross-linking via chondroitin 4-sulfate glycosaminoglycan	ISS	biological process
GO:0010811	positive regulation of cell-substrate adhesion	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R