• Gene id: 79624

Gene Summary

• Gene Symbol: ARMT1   Gene   UCSC   Ensembl
• Aliases: C6orf211
• Gene name: acidic residue methyltransferase 1
• Alternate names: damage-control phosphatase ARMT1, UPF0364 protein C6orf211, protein-glutamate O-methyltransferase, sugar phosphate phosphatase ARMT1,
• Gene location: 6q25.1 (151452257: 151470100)     Exons: 5     NC_000006.12
• OMIM: 616332

Protein Summary

• Protein general information: Q9H993  
  • Name: Damage control phosphatase ARMT1 (EC 3.1.3. ) (Acidic residue methyltransferase 1) (Protein glutamate O methyltransferase) (EC 2.1.1. ) (Sugar phosphate phosphatase ARMT1)
  • Length: 441  
  • Mass: 51172
• Sequence:

  MAVVPASLSGQDVGSFAYLTIKDRIPQILTKVIDTLHRHKSEFFEKHGEEGVEAEKKAISLLSKLRNELQTDKPF
  IPLVEKFVDTDIWNQYLEYQQSLLNESDGKSRWFYSPWLLVECYMYRRIHEAIIQSPPIDYFDVFKESKEQNFYG
  SQESIIALCTHLQQLIRTIEDLDENQLKDEFFKLLQISLWGNKCDLSLSGGESSSQNTNVLNSLEDLKPFILLND
  MEHLWSLLSNCKKTREKASATRVYIVLDNSGFELVTDLILADFLLSSELATEVHFYGKTIPWFVSDTTIHDFNWL
  IEQVKHSNHKWMSKCGADWEEYIKMGKWVYHNHIFWTLPHEYCAMPQVAPDLYAELQKAHLILFKGDLNYRKLTG
  DRKWEFSVPFHQALNGFHPAPLCTIRTLKAEIQVGLQPGQGEQLLASEPSWWTTGKYGIFQYDGPL

• Structural information:
  • Interpro: IPR036075  IPR039763  IPR002791  
  • STRING: ENSP00000356263
• Other Databases: GeneCards:  ARMT1  Malacards:  ARMT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:2001020	regulation of response to DNA damage stimulus	IBA	biological process
GO:0016791	phosphatase activity	IBA	molecular function
GO:0032259	methylation	IDA	biological process
GO:0008757	S-adenosylmethionine-dependent methyltransferase activity	IDA	molecular function
GO:0051998	protein carboxyl O-methyltransferase activity	IDA	molecular function
GO:2001020	regulation of response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0051998	protein carboxyl O-methyltransferase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016311	dephosphorylation	IEA	biological process
GO:0006479	protein methylation	IEA	biological process
GO:0006479	protein methylation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)