• Gene id: 79612

Gene Summary

• Gene Symbol: NAA16   Gene   UCSC   Ensembl
• Aliases: NARG1L
• Gene name: N-alpha-acetyltransferase 16, NatA auxiliary subunit
• Alternate names: N-alpha-acetyltransferase 16, NatA auxiliary subunit, NARG1-like protein, NMDA receptor-regulated 1-like protein,
• Gene location: 13q14.11 (41311238: 41377030)     Exons: 23     NC_000013.11

Protein Summary

• Protein general information: Q6N069  
  • Name: N alpha acetyltransferase 16, NatA auxiliary subunit (NMDA receptor regulated 1 like protein) (NARG1 like protein)
  • Length: 864  
  • Mass: 101462
• Sequence:

  MPNVLLPPKESNLFKRILKCYEQKQYKNGLKFCKMILSNPKFAEHGETLAMKGLTLNCLGKKEEAYEFVRKGLRN
  DVKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKLDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPTQRAS
  WIGYAIAYHLLKDYDMALKLLEEFRQTQQVPPNKIDYEYSELILYQNQVMREADLLQESLEHIEMYEKQICDKLL
  VEEIKGEILLKLGRLKEASEVFKNLIDRNAENWCYYEGLEKALQISTLEERLQIYEEISKQHPKAITPRRLPLTL
  VPGERFRELMDKFLRVNFSKGCPPLFTTLKSLYYNTEKVSIIQELVTNYEASLKTCDFFSPYENGEKEPPTTLLW
  VQYFLAQHFDKLGQYSLALDYINAAIASTPTLIELFYMKAKIYKHIGNLKEAAKWMDEAQSLDTADRFINSKCAK
  YMLRANMIKEAEEMCSKFTREGTSAMENLNEMQCMWFQTECISAYQRLGRYGDALKKCHEVERHFFEITDDQFDF
  HTYCMRKMTLRAYVDLLRLEDILRRHAFYFKAARSAIEIYLKLYDNPLTNESKQQEINSENLSAKELKKMLSKQR
  RAQKKAKLEEERKHAERERQQKNQKKKRDEEEEEASGLKEELIPEKLERVENPLEEAVKFLIPLKNLVADNIDTH
  LLAFEIYFRKGKFLLMLQSVKRAFAINSNNPWLHECLIRFSKSVSNHSNLPDIVSKVLSQEMQKIFVKKDLESFN
  EDFLKRNATSLQHLLSGAKMMYFLDKSRQEKAIAIATRLDETIKDKDVKTLIKVSEALLDGSFGNCSSQYEEYRM
  ACHNLLPFTSAFLPAVNEVDNPNVALNHTANYDVLANEI

• Structural information:
  • Interpro: IPR021183  IPR013026  IPR011990  IPR013105  IPR019734  
  • Prosite: PS50005 PS50293
  • STRING: ENSP00000368716
• Other Databases: GeneCards:  NAA16  Malacards:  NAA16

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004596	peptide alpha-N-acetyltransferase activity	IBA	contributes to
GO:0005737	cytoplasm	IBA	cellular component
GO:0017196	N-terminal peptidyl-methionine acetylation	IBA	biological process
GO:0031415	NatA complex	IBA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031415	NatA complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0043022	ribosome binding	IDA	molecular function
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0050821	protein stabilization	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005667	transcription regulator complex	ISS	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0006474	N-terminal protein amino acid acetylation	ISS	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0043022	ribosome binding	ISS	contributes to
GO:0016407	acetyltransferase activity	ISS	contributes to

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray