• Gene id: 79602

Gene Summary

• Gene Symbol: ADIPOR2   Gene   UCSC   Ensembl
• Aliases: ACDCR2, PAQR2
• Gene name: adiponectin receptor 2
• Alternate names: adiponectin receptor protein 2, progestin and adipoQ receptor family member 2, progestin and adipoQ receptor family member II,
• Gene location: 12p13.33 (1691058: 1788673)     Exons: 11     NC_000012.12
• Gene summary(Entrez): The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid o
• OMIM: 607946

Protein Summary

• Protein general information: Q86V24  
  • Name: Adiponectin receptor protein 2 (Progestin and adipoQ receptor family member 2) (Progestin and adipoQ receptor family member II)
  • Length: 386  
  • Mass: 43884
  • Tissue specificity: Ubiquitous (PubMed
• Sequence:

  MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGF
  MGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIW
  THLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIAL
  LIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISE
  GFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFM
  IGGGCSEEDAL

• Structural information:
  • Interpro: IPR004254  
  • PDB: 3WXW 5LWY 5LX9 5LXA
  • PDBsum: 3WXW 5LWY 5LX9 5LXA
  • STRING: ENSP00000349616
• Other Databases: GeneCards:  ADIPOR2  Malacards:  ADIPOR2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0033211	adiponectin-activated signaling pathway	IBA	biological process
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0055100	adiponectin binding	IDA	molecular function
GO:0033211	adiponectin-activated signaling pathway	IDA	biological process
GO:0031226	intrinsic component of plasma membrane	IDA	cellular component
GO:0097003	adipokinetic hormone receptor activity	IDA	molecular function
GO:0042593	glucose homeostasis	ISS	biological process
GO:0061042	vascular wound healing	ISS	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0042304	regulation of fatty acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0007584	response to nutrient	IEA	biological process
GO:0007565	female pregnancy	IEA	biological process
GO:0055100	adiponectin binding	IEA	molecular function
GO:0042593	glucose homeostasis	IEA	biological process
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0007507	heart development	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0061042	vascular wound healing	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0033211	adiponectin-activated signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0019395	fatty acid oxidation	ISS	biological process
GO:0009755	hormone-mediated signaling pathway	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04932	Non-alcoholic fatty liver disease
hsa04152	AMPK signaling pathway
hsa04211	Longevity regulating pathway
hsa04920	Adipocytokine signaling pathway

Diseases

Associated diseases	References
Non-alcoholic fatty liver disease	PMID:25345946
type 2 diabetes mellitus	PMID:18363889
type 2 diabetes mellitus	PMID:18075289
type 2 diabetes mellitus	PMID:18548168
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray