• Gene id: 79585

Gene Summary

• Gene Symbol: CORO7   Gene   UCSC   Ensembl
• Aliases: 0610011B16Rik, CRN7, POD1
• Gene name: coronin 7
• Alternate names: coronin-7, 70 kDa WD repeat tumor rejection antigen homolog,
• Gene location: 16p13.3 (4416595: 4354541)     Exons: 29     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the coronin protein family. However, unlike other coronin proteins, it is not an actin-binding protein but rather functions as an F-actin regulator directing anterograde Golgi to endosome transport. The encoded protein has tw
• OMIM: 607081

Protein Summary

• Protein general information: P57737  
  • Name: Coronin 7 (Crn7) (70 kDa WD repeat tumor rejection antigen homolog)
  • Length: 925  
  • Mass: 100605
  • Tissue specificity: Widely expressed. Expressed in the spleen, peripheral leukocytes, testes, brain, thymus and small intestine. {ECO
• Sequence:

  MNRFRVSKFRHTEARPPRRESWISDIRAGTAPSCRNHIKSSCSLIAFNSDRPGVLGIVPLQGQGEDKRRVAHLGC
  HSDLVTDLDFSPFDDFLLATGSADRTVKLWRLPGPGQALPSAPGVVLGPEDLPVEVLQFHPTSDGILVSAAGTTV
  KVWDAAKQQPLTELAAHGDLVQSAVWSRDGALVGTACKDKQLRIFDPRTKPRASQSTQAHENSRDSRLAWMGTWE
  HLVSTGFNQMREREVKLWDTRFFSSALASLTLDTSLGCLVPLLDPDSGLLVLAGKGERQLYCYEVVPQQPALSPV
  TQCVLESVLRGAALVPRQALAVMSCEVLRVLQLSDTAIVPIGYHVPRKAVEFHEDLFPDTAGCVPATDPHSWWAG
  DNQQVQKVSLNPACRPHPSFTSCLVPPAEPLPDTAQPAVMETPVGDADASEGFSSPPSSLTSPSTPSSLGPSLSS
  TSGIGTSPSLRSLQSLLGPSSKFRHAQGTVLHRDSHITNLKGLNLTTPGESDGFCANKLRVAVPLLSSGGQVAVL
  ELRKPGRLPDTALPTLQNGAAVTDLAWDPFDPHRLAVAGEDARIRLWRVPAEGLEEVLTTPETVLTGHTEKICSL
  RFHPLAANVLASSSYDLTVRIWDLQAGADRLKLQGHQDQIFSLAWSPDGQQLATVCKDGRVRVYRPRSGPEPLQE
  GPGPKGGRGARIVWVCDGRCLLVSGFDSQSERQLLLYEAEALAGGPLAVLGLDVAPSTLLPSYDPDTGLVLLTGK
  GDTRVFLYELLPESPFFLECNSFTSPDPHKGLVLLPKTECDVREVELMRCLRLRQSSLEPVAFRLPRVRKEFFQD
  DVFPDTAVIWEPVLSAEAWLQGANGQPWLLSLQPPDMSPVSQAPREAPARRAPSSAQYLEEKSDQQKKEELLNAM
  VAKLGNREDPLPQDSFEGVDEDEWD

• Structural information:
  • Interpro: IPR027331  IPR015505  IPR015048  IPR020472  IPR015943   IPR001680  IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • STRING: ENSP00000460885
• Other Databases: GeneCards:  CORO7  Malacards:  CORO7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007015	actin filament organization	IBA	biological process
GO:0051015	actin filament binding	IBA	molecular function
GO:0003779	actin binding	IDA	molecular function
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0030041	actin filament polymerization	IMP	biological process
GO:0006895	Golgi to endosome transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016021	integral component of membrane	ISS	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq