Search Result
| Gene id | 795 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | S100G Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | CABP, CABP1, CABP9K, CALB3 | ||||||||||||||||||||||||||||||||||||
| Gene name | S100 calcium binding protein G | ||||||||||||||||||||||||||||||||||||
| Alternate names | protein S100-G, calbindin 3, (vitamin D-dependent calcium-binding protein), calbindin D9K, calbindin-D9k, vitamin D-dependent calcium-binding protein, intestinal, | ||||||||||||||||||||||||||||||||||||
| Gene location |
Xp22.2 (16649786: 16654673) Exons: 3 NC_000023.11 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes calbindin D9K, a vitamin D-dependent calcium-binding protein. This cytosolic protein belongs to a family of calcium-binding proteins that includes calmodulin, parvalbumin, troponin C, and S100 protein. In the intestine, the protein is vi |
||||||||||||||||||||||||||||||||||||
| OMIM | 191042 | ||||||||||||||||||||||||||||||||||||
SNPs |
rs397515484 Strand: Allele origin: Allele change: Mutation type: snv NC_000019.10 g.57233458A>G NC_000019.9 g.57744826A>G NG_012134.1 g.7450A>G|SEQ=[A/G]|GENE=AURKC rs28606463 Strand: Allele origin: Allele change: Mutation type: snv NC_000002.12 g.213929934C>T NC_000002.11 g.214794658C>T|SEQ=[C/T]|GENE=SPAG16 rs16851495 Strand: Allele origin: Allele change: Mutation type: snv NC_000002.12 g.214108287G>A NC_000002.11 g.214973011G>A|SEQ=[G/A]|GENE=SPAG16 rs12988374 Strand: Allele origin: Allele change: Mutation type: snv NC_000002.12 g.214410278C>T NC_000002.11 g.215275002C>T NM_024532.5 c.1859C>T NM_024532.4 c.1859C>T XM_011511823.3 c.1550C>T XM_011511821.2 c.1577C>T XM_011511819.2 c.1697C>T XM_011511820.2 c.1673C>T XM_017004897.1 c.1502C>T NR_047659.1 n.2139C>T XM_ rs12988372 Strand: Allele origin: Allele change: Mutation type: snv NC_000002.12 g.214410273C>A NC_000002.12 g.214410273C>T NC_000002.11 g.215274997C>A NC_000002.11 g.215274997C>T NM_024532.5 c.1854C>A NM_024532.5 c.1854C>T NM_024532.4 c.1854C>A NM_024532.4 c.1854C>T XM_011511823.3 c.1545C>A XM_011511823.3 c.1545C>T rs12623569 Strand: Allele origin: Allele change: Mutation type: snv NC_000002.12 g.213930019A>C NC_000002.11 g.214794743A>C NM_024532.5 c.1274A>C NM_024532.4 c.1274A>C XM_011511823.3 c.965A>C XM_011511816.3 c.1274A>C XM_011511821.2 c.992A>C XM_011511819.2 c.1112A>C XM_011511815.2 c.1274A>C XM_011511817.2 c.1274A>C XM rs10167688 Strand: Allele origin: Allele change: Mutation type: snv NC_000002.12 g.213489990C>A NC_000002.11 g.214354714C>A NM_024532.5 c.970C>A NM_024532.4 c.970C>A XM_011511823.3 c.661C>A XM_011511816.3 c.970C>A XM_011511821.2 c.688C>A XM_011511819.2 c.808C>A XM_011511820.2 c.970C>A XM_011511815.2 c.970C>A XM_01151 |
||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | P29377 Name: Protein S100 G (Calbindin D9k) (S100 calcium binding protein G) (Vitamin D dependent calcium binding protein, intestinal) (CABP) Length: 79 Mass: 9016 | ||||||||||||||||||||||||||||||||||||
| Sequence |
MSTKKSPEELKRIFEKYAAKEGDPDQLSKDELKLLIQAEFPSLLKGPNTLDDLFQELDKNGDGEVSFEEFQVLVK KISQ | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: S100G  Malacards: S100G | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||