• Gene id: 79153

Gene Summary

• Gene Symbol: GDPD3   Gene   UCSC   Ensembl
• Aliases: GDE7
• Gene name: glycerophosphodiester phosphodiesterase domain containing 3
• Alternate names: lysophospholipase D GDPD3, glycerophosphodiester phosphodiesterase 7, glycerophosphodiester phosphodiesterase domain-containing protein 3,
• Gene location: 16p11.2 (30113536: 30104809)     Exons: 10     NC_000016.10
• OMIM: 616318

Protein Summary

• Protein general information: Q7L5L3  
  • Name: Lysophospholipase D GDPD3 (EC 3.1.4. ) (Glycerophosphodiester phosphodiesterase 7) (Glycerophosphodiester phosphodiesterase domain containing protein 3)
  • Length: 318  
  • Mass: 36596
• Sequence:

  MSLLLYYALPALGSYAMLSIFFLRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQ
  LTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVE
  IKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKF
  FFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDY
  PTALRHYLDNHGPAARTS

• Structural information:
  • Protein Domains: (39..30-)
    (/note="GP-PDE"-)
  • Interpro: IPR030395  IPR017946  
  • Prosite: PS51704
  • STRING: ENSP00000384363
• Other Databases: GeneCards:  GDPD3  Malacards:  GDPD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008081	phosphoric diester hydrolase activity	IBA	molecular function
GO:0046475	glycerophospholipid catabolic process	IBA	biological process
GO:0004622	lysophospholipase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0006644	phospholipid metabolic process	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	ISS	cellular component
GO:0048471	perinuclear region of cytoplasm	ISS	cellular component
GO:0005783	endoplasmic reticulum	IMP	cellular component
GO:0070291	N-acylethanolamine metabolic process	IMP	biological process
GO:0008081	phosphoric diester hydrolase activity	IMP	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008081	phosphoric diester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0034638	phosphatidylcholine catabolic process	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa00565	Ether lipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq