|
Gene id |
79144 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
PPDPF Gene UCSC Ensembl |
|
Aliases |
C20orf149, dJ697K14.9, exdpf |
|
Gene name |
pancreatic progenitor cell differentiation and proliferation factor |
|
Alternate names |
pancreatic progenitor cell differentiation and proliferation factor, exocrine differentiation and proliferation factor, pancreatic progenitor cell differentiation and proliferation factor homolog, |
|
Gene location |
20q13.33 (63520740: 63522205) Exons: 4 NC_000020.11
|
Protein Summary
|
| Protein general information
| Q9H3Y8
Name: Pancreatic progenitor cell differentiation and proliferation factor (Exocrine differentiation and proliferation factor)
Length: 114 Mass: 11777
|
| Sequence |
MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESA EHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS
|
| Structural information |
|
| Other Databases |
GeneCards: PPDPF  Malacards: PPDPF |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0030154 |
cell differentiation
|
IEA |
biological process |
GO:0007275 |
multicellular organism de velopment
|
IEA |
biological process |
GO:0030154 |
cell differentiation
|
IEA |
biological process |
GO:0007275 |
multicellular organism de velopment
|
IEA |
biological process |
|
|
| Associated diseases |
References |
| Aberrant CpGs in Low Motility Sperm | MIK: 21674046 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
19 (6 controls , 13 cases)
|
Male infertility |
GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 21674046 |
Aberrant C pGs in Low Motility Sperm
|
|
|
18
|
Male infertility |
GSE26881
|
Show abstract |
|