• Gene id: 79134

Gene Summary

• Gene Symbol: TMEM185B   Gene   UCSC   Ensembl
• Aliases: FAM11B
• Gene name: transmembrane protein 185B
• Alternate names: transmembrane protein 185B, ee3_2, family with sequence similarity 11, member B, putative transmembrane protein 185B, transmembrane protein 185B (pseudogene),
• Gene location: 2q14.2 (120223399: 120217478)     Exons: 1     NC_000002.12
• OMIM: 0

Protein Summary

• Protein general information: Q9H7F4  
  • Name: Transmembrane protein 185B (Protein FAM11B)
  • Length: 350  
  • Mass: 40599
• Sequence:

  MNPRGLFQDFNPSKFLIYTCLLLFSVLLPLRLDGIIQWSYWAVFAPIWLWKLLVVAGASVGAGVWARNPRYRTEG
  EACVEFKAMLIAVGIHLLLLMFEVLVCDRVERGTHFWLLVFMPLFFVSPVSVAACVWGFRHDRSLELEILCSVNI
  LQFIFIALKLDRIIHWPWLVVFVPLWILMSFLCLVVLYYIVWSLLFLRSLDVVAEQRRTHVTMAISWITIVVPLL
  TFEVLLVHRLDGHNTFSYVSIFVPLWLSLLTLMATTFRRKGGNHWWFGIRRDFCQFLLEIFPFLREYGNISYDLH
  HEDSEDAEETSVPEAPKIAPIFGKKARVVITQSPGKYVPPPPKLNIDMPD

• Structural information:
  • Interpro: IPR019396  
  • STRING: ENSP00000453399
• Other Databases: GeneCards:  TMEM185B  Malacards:  TMEM185B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)