• Gene id: 79048

Gene Summary

• Gene Symbol: SECISBP2   Gene   UCSC   Ensembl
• Aliases: SBP2
• Gene name: SECIS binding protein 2
• Alternate names: selenocysteine insertion sequence-binding protein 2, Sec insertion sequence-binding protein 2,
• Gene location: 9q22.2 (89318499: 89367116)     Exons: 22     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is one of the essential components of the machinery involved in co-translational insertion of selenocysteine (Sec) into selenoproteins. Sec is encoded by the UGA codon, which normally signals translation termination. The r
• OMIM: 153390

Protein Summary

• Protein general information: Q96T21  
  • Name: Selenocysteine insertion sequence binding protein 2 (SECIS binding protein 2)
  • Length: 854  
  • Mass: 95462
  • Tissue specificity: Expressed at high levels in testis. {ECO
• Sequence:

  MASEGPREPESEGIKLSADVKPFVPRFAGLNVAWLESSEACVFPSSAATYYPFVQEPPVTEQKIYTEDMAFGAST
  FPPQYLSSEITLHPYAYSPYTLDSTQNVYSVPGSQYLYNQPSCYRGFQTVKHRNENTCPLPQEMKALFKKKTYDE
  KKTYDQQKFDSERADGTISSEIKSARGSHHLSIYAENSLKSDGYHKRTDRKSRIIAKNVSTSKPEFEFTTLDFPE
  LQGAENNMSEIQKQPKWGPVHSVSTDISLLREVVKPAAVLSKGEIVVKNNPNESVTANAATNSPSCTRELSWTPM
  GYVVRQTLSTELSAAPKNVTSMINLKTIASSADPKNVSIPSSEALSSDPSYNKEKHIIHPTQKSKASQGSDLEQN
  EASRKNKKKKEKSTSKYEVLTVQEPPRIEDAEEFPNLAVASERRDRIETPKFQSKQQPQDNFKNNVKKSQLPVQL
  DLGGMLTALEKKQHSQHAKQSSKPVVVSVGAVPVLSKECASGERGRRMSQMKTPHNPLDSSAPLMKKGKQREIPK
  AKKPTSLKKIILKERQERKQRLQENAVSPAFTSDDTQDGESGGDDQFPEQAELSGPEGMDELISTPSVEDKSEEP
  PGTELQRDTEASHLAPNHTTFPKIHSRRFRDYCSQMLSKEVDACVTDLLKELVRFQDRMYQKDPVKAKTKRRLVL
  GLREVLKHLKLKKLKCVIISPNCEKIQSKGGLDDTLHTIIDYACEQNIPFVFALNRKALGRSLNKAVPVSVVGIF
  SYDGAQDQFHKMVELTVAARQAYKTMLENVQQELVGEPRPQAPPSLPTQGPSCPAEDGPPALKEKEEPHYIEIWK
  KHLEAYSGCTLELEESLEASTSQMMNLNL

• Structural information:
  • Interpro: IPR029064  IPR004038  IPR040051  
  • STRING: ENSP00000364965
• Other Databases: GeneCards:  SECISBP2  Malacards:  SECISBP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0035368	selenocysteine insertion sequence binding	IBA	molecular function
GO:0043021	ribonucleoprotein complex binding	IBA	molecular function
GO:0001514	selenocysteine incorporation	IBA	biological process
GO:1990904	ribonucleoprotein complex	IBA	cellular component
GO:0035368	selenocysteine insertion sequence binding	IEA	molecular function
GO:0006412	translation	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035368	selenocysteine insertion sequence binding	IEA	molecular function
GO:0043021	ribonucleoprotein complex binding	IEA	molecular function
GO:0048666	neuron development	IEA	biological process
GO:2000623	negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0001514	selenocysteine incorporation	IEA	biological process
GO:0021756	striatum development	IEA	biological process
GO:1990904	ribonucleoprotein complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Abnormal thyroid hormone metabolism	KEGG:H01186
Abnormal thyroid hormone metabolism	KEGG:H01186
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 21084748

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
21084748	Azoospermia				Male infertility