• Gene id: 79018

Gene Summary

• Gene Symbol: GID4   Gene   UCSC   Ensembl
• Aliases: C17orf39, VID2, VID24
• Gene name: GID complex subunit 4 homolog
• Alternate names: glucose-induced degradation protein 4 homolog, GID complex subunit 4, VID24 homolog, vacuolar import and degradation 24, vacuolar import and degradation protein 24 homolog,
• Gene location: 17p11.2 (18039407: 18068404)     Exons: 8     NC_000017.11
• Gene summary(Entrez): The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located wit
• OMIM: 617699

Protein Summary

• Protein general information: Q8IVV7  
  • Name: Glucose induced degradation protein 4 homolog (Vacuolar import and degradation protein 24 homolog)
  • Length: 300  
  • Mass: 33514
• Sequence:

  MCARGQVGRGTQLRTGRPCSQVPGSRWRPERLLRRQRAGGRPSRPHPARARPGLSLPATLLGSRAAAAVPLPLPP
  ALAPGDPAMPVRTECPPPAGASAASAASLIPPPPINTQQPGVATSLLYSGSKFRGHQKSKGNSYDVEVVLQHVDT
  GNSYLCGYLKIKGLTEEYPTLTTFFEGEIISKKHPFLTRKWDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEEL
  KNGDYVFMRWKEQFLVPDHTIKDISGASFAGFYYICFQKSAASIEGYYYHRSSEWYQSLNLTHVPEHSAPIYEFR

• Structural information:
  • Interpro: IPR018618  
  • PDB: 6CCR 6CCT 6CCU 6CD8 6CD9 6CDC 6CDG
  • PDBsum: 6CCR 6CCT 6CCU 6CD8 6CD9 6CDC 6CDG
  • STRING: ENSP00000268719
• Other Databases: GeneCards:  GID4  Malacards:  GID4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R