• Gene id: 79012

Gene Summary

• Gene Symbol: CAMKV   Gene   UCSC   Ensembl
• Aliases: 1G5, VACAMKL
• Gene name: CaM kinase like vesicle associated
• Alternate names: caM kinase-like vesicle-associated protein, testis tissue sperm-binding protein Li 52e, vesicle-associated calmodulin-binding protein,
• Gene location: 3p21.31 (49869905: 49857988)     Exons: 11     NC_000003.12

Protein Summary

• Protein general information: Q8NCB2  
  • Name: CaM kinase like vesicle associated protein
  • Length: 501  
  • Mass: 54354
• Sequence:

  MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQKRDGRKVRKAAKNEIGILK
  MVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSERDTSNVVRQVLEAVAYLHSLKIVHRNLKLEN
  LVYYNRLKNSKIVISDFHLAKLENGLIKEPCGTPEYLAPEVVGRQRYGRPVDCWAIGVIMYILLSGNPPFYEEVE
  EDDYENHDKNLFRKILAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGV
  CAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGAAGGATAAAASGATSAPEGDAARAAK
  SDNVAPADRSATPATDGSATPATDGSVTPATDGSITPATDGSVTPATDRSATPATDGRATPATEESTVPTTQSSA
  MLATKAAATPEPAMAQPDSTAPEGATGQAPPSSKGEEAAGYAQESQREEAS

• Structural information:
  • Protein Domains: (24..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  
  • Prosite: PS50011
  • STRING: ENSP00000419195
• Other Databases: GeneCards:  CAMKV  Malacards:  CAMKV

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004683	calmodulin-dependent protein kinase activity	IBA	molecular function
GO:0005516	calmodulin binding	IBA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005516	calmodulin binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0099159	regulation of modification of postsynaptic structure	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray