• Gene id: 78995

Gene Summary

• Gene Symbol: HROB   Gene   UCSC   Ensembl
• Aliases: C17orf53, MCM8IP
• Gene name: homologous recombination factor with OB-fold
• Alternate names: homologous recombination OB-fold protein, uncharacterized protein C17orf53, MCM8-9-Interacting Protein), homologous recombincation factor with OB-fold,
• Gene location: 17q21.31 (44141929: 44162476)     Exons: 11     NC_000017.11
• OMIM: 608077

Protein Summary

• Protein general information: Q8N3J3  
  • Name: Homologous recombination OB fold protein
  • Length: 647  
  • Mass: 69771
• Sequence:

  MACSLQKLFAVEEEFEDEDFLSAVEDAENRFTGSLPVNAGRLRPVSSRPQETVQAQSSRLLLLHPTAPSEALGLP
  DLDLCLPASSTPSADSRPSCIGAAPLRPVSTSSSWIGNQRRVTVTEVLRETARPQSSALHPLLTFESQQQQVGGF
  EGPEQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSA
  QDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQPLQAARGTIQSSPQNRFPCQP
  FQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSSIGSPVGTPKGPQGALQTPIVTNHLVQL
  VTAASRTPQQPTHPSTRAKTRRFPGPAGILPHQQSGRSLEDIMVSAPQTPTHGALAKFQTEIVASSQASVEEDFG
  RGPWLTMKSTLGLDERDPSCFLCTYSIVMVLRKQAALKQLPRNKVPNMAVMIKSLTRSTMDASVVFKDPTGEMQG
  TVHRLLLETCQNELKPGSVLLLKQIGVFSPSLRNHYLNVTPNNLVHIYSPDSGDGSFLKPSQPFPKDSGSFQHDV
  AAKPEEGFRTAQNLEAEASPEEELPEADDLDGLLSELPEDFFCGTSS

• Structural information:
  • Interpro: IPR028045  
  • STRING: ENSP00000313500
• Other Databases: GeneCards:  HROB  Malacards:  HROB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IBA	molecular function
GO:0000731	DNA synthesis involved in DNA repair	IMP	biological process
GO:0048232	male gamete generation	ISS	biological process
GO:0090734	site of DNA damage	IMP	cellular component
GO:0036297	interstrand cross-link repair	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0007292	female gamete generation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000725	recombinational repair	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0006310	DNA recombination	IEA	biological process
GO:0071897	DNA biosynthetic process	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0048232	male gamete generation	IEA	biological process
GO:0007292	female gamete generation	IEA	biological process
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881