Search Result
| Gene id | 788 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SLC25A20 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CAC, CACT | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | solute carrier family 25 member 20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | mitochondrial carnitine/acylcarnitine carrier protein, solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
3p21.31 (48898881: 48856925) Exons: 9 NC_000003.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix fo |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs2231599 Strand: Allele origin: Allele change: Mutation type: snv NC_000001.11 g.86574546A>G NC_000001.10 g.87040229A>G NM_012128.4 c.1474A>G NM_012128.3 c.1474A>G XM_011541015.2 c.1321A>G NR_024602.1 n.1409A>G NR_024602.2 n.1407A>G NP_036260.2 p.Ser492Gly XP_011539317.1 p.Ser441Gly|SEQ=[A/G]|GENE=CLCA4 CLCA4 rs759981524 Strand: Allele origin: Allele change: Mutation type: snv NC_000001.11 g.86579956A>C NC_000001.11 g.86579956A>G NC_000001.11 g.86579956A>T NC_000001.10 g.87045639A>C NC_000001.10 g.87045639A>G NC_000001.10 g.87045639A>T NM_012128.4 c.2371A>C NM_012128.4 c.2371A>G NM_012128.4 c.2371A>T NM_012128.3 c.2371A>C rs757773924 Strand: Allele origin: Allele change: Mutation type: snv NC_000001.11 g.86578055C>G NC_000001.11 g.86578055C>T NC_000001.10 g.87043738C>G NC_000001.10 g.87043738C>T NM_012128.4 c.2105C>G NM_012128.4 c.2105C>T NM_012128.3 c.2105C>G NM_012128.3 c.2105C>T XM_011541015.2 c.1952C>G XM_011541015.2 c.1952C>T NR_0 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O43772 Name: Mitochondrial carnitine/acylcarnitine carrier protein (Carnitine/acylcarnitine translocase) (CAC) (Solute carrier family 25 member 20) Length: 301 Mass: 32944 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGM AAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYT GTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWA VAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPN L | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SLC25A20  Malacards: SLC25A20 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||