• Gene id: 7773

Gene Summary

• Gene Symbol: ZNF230   Gene   UCSC   Ensembl
• Aliases: FDZF2
• Gene name: zinc finger protein 230
• Alternate names: zinc finger protein 230, zinc finger protein FDZF2,
• Gene location: 19q13.31 (44002924: 44013919)     Exons: 5     NC_000019.10
• OMIM: 0

Protein Summary

• Protein general information: Q9UIE0  
  • Name: Zinc finger protein 230 (Zinc finger protein FDZF2)
  • Length: 474  
  • Mass: 54,542
• Sequence:

  MTTFKEAVTFKDVAVFFTEEELGLLDPAQRKLYQDVMLENFTNLLSVGHQPFHPFHFLREEKFWMMETATQREGN
  SGGKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPSQNGKCKQSFS
  DVAIFDPPQQFHSGEKSHTCNECGKSFCYISALRIHQRVHLREKLSKCDMRGKEFSQSSCLQTRERVHTGEKPFK
  CEQCGKGFRCRAILQVHCKLHTGEKPYICEKCGRAFIHDFQLQKHQIIHTGEKPFKCEICGKSFCLRSSLNRHCM
  VHTAEKLYKSEECGKGFTDSLDLHKHQIIHTGQKPYNCKECGKSFRWSSYLLIHQRIHSGEKPYRCEECGKGYIS
  KSGLNLHQRVHTGERPYNCKECGKSFSRASSILNHKKLHCRKKPFKCEDCGKRLVHRSFCKDQQGDHNGENSSKC
  EDCGKRYKRRLNLDIILSLFLNDM

• Structural information:
  • Protein Domains: KRAB. (8-76)
  • Interpro: IPR001909  IPR036051  IPR036236  IPR013087  
  • Prosite: PS50805 PS00028 PS50157
  • CDD: cd07765
  • STRING: ENSP00000409318
• Other Databases: GeneCards:  ZNF230  Malacards:  ZNF230

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05168	Herpes simplex virus 1 infection

Diseases

Associated diseases	References
Cancer	GAD: 19684603
Cancer (leukemia)	GAD: 19684603
Cancer (lung)	GAD: 18676680
Cancer (bladder)	GAD: 19692168
Azoospermia	MIK: 15952109
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Azoospermia	MIK: 15952109
Male infertility	MIK: 11672448
Spermatogenic defects	MIK: 12804569
Fertilization defects	MIK: 18823591
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15952109	Azoospermia	ZNF230 (A316G)		214 (99 patients with azoospermia, 115 healthy men as controls)	Male infertility	ZNF230
18823591	Play an important role in mouse spermatogenesis, including spermatogenic cell proliferation and sperm maturation, as well as motility and fertilization				Male infertility
12804569	May function as a testis specific transcription factor during mouse spermatogenesis				Male infertility
11672448	Azoospermia, Male infertility				Male infertility
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)