Search Result
| Gene id | 7762 | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | ZNF215 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||
| Aliases | BAZ-2, BAZ2, ZKSCAN11, ZSCAN43 | ||||||||||||||||||||||||||||||||||||||||||||
| Gene name | zinc finger protein 215 | ||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | zinc finger protein 215, BWSCR2-associated zinc finger protein 2, zinc finger protein with KRAB and SCAN domains 11, | ||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
11p15.4 (6926425: 6991143) Exons: 10 NC_000011.10 |
||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene is imprinted in a tissue-specific manner with preferential expression in the testis, and encodes a zinc finger protein that belongs to a family of zinc finger transcription factors. The encoded protein contains an N-terminal SRE-ZBP, Ctfin51, AW |
||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs28362491 Strand: Allele origin: Allele change: Mutation type: delins NC_000004.12 g.102500998_102501001ATTG[1] NC_000004.11 g.103422155_103422158ATTG[1] NG_050628.1 g.4670_4673ATTG[1]|SEQ=[ATTG/-]|GENE=NFKB1 LOC105377621 105377621 |
||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q9UL58 Name: Zinc finger protein 215 (BWSCR2 associated zinc finger protein 2) (BAZ 2) (Zinc finger protein with KRAB and SCAN domains 11) Length: 517 Mass: 60034 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MQPLSKLMAISKPRNLSLREQREVLRADMSWQQETNPVVETHDSEASRQKFRHFQYLKVSGPHEALSQLWELCLQ WLRPEIHTKKQIIELLVLEQFLAILPEEVRTWVNLQHPNNSKDMVTLIEDVIEMLEDEDMPCKDSALQMGSIKEK MKAGSRTGKPQEPVTFKDVVVEFSKEEWGQLDSAVKNLYRNVMLENFRNLNSLRKAHLLSKPFESLKLESKKKRW IMEKEIPRKTIFDMKSISGEESSHGVIMTRLTESGHPSSDAWKGENWLYRNQKKWDINLPQEAFIPETIYTEEED FECSENKKSFDINSVSSICAIQVGIPSRKGSPKCDKFKTYFKFNLDSVGKQHSEYEYGNDLSLSTDIRHQKSHTT MNSYECYQCGKAFCRSSSLIRHQIIHTGEKPYKCSECGRFFNRRTNLTKHQKLHAEAKACTSNKCGKAFSKSEDS NNPTLHFGNNFYQCVNCGKSFNRSSSLIRHQMIHTGEKPFKCKECSKAFNRSSNLVKHQKLHTRDKS | ||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: ZNF215  Malacards: ZNF215 | ||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||