• Gene id: 7745

Gene Summary

• Gene Symbol: ZKSCAN8   Gene   UCSC   Ensembl
• Aliases: LD5-1, ZNF192, ZSCAN40
• Gene name: zinc finger with KRAB and SCAN domains 8
• Alternate names: zinc finger protein with KRAB and SCAN domains 8, zinc finger protein 192,
• Gene location: 6p22.1 (28141642: 28159471)     Exons: 9     NC_000006.12
• OMIM: 613741

Protein Summary

• Protein general information: Q15776  
  • Name: Zinc finger protein with KRAB and SCAN domains 8 (LD5 1) (Zinc finger protein 192)
  • Length: 578  
  • Mass: 65816
• Sequence:

  MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQETLGPREALIQLRAL
  CHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGEEVVTLLEDLERQIDILGRPVSARVHGHRVL
  WEEVVHSASAPEPPNTQLQSEATQHKSPVPQESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKIEDM
  AVSLIREEWLLDPSQKDLCRDNRPENFRNMFSLGGETRSENRELASKQVISTGIQPHGETAAKCNGDVIRGLEHE
  EARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFSYRSALLSHQDIHNKV
  KRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAGLILHQRIHSGERPYECNECGKAFSHSSHLI
  GHQRIHTGEKPYECDECGKTFRRSSHLIGHQRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGK
  AFNGNTGLIQHLRIHTGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESISV

• Structural information:
  • Protein Domains: (51..13-)
    (/note="SCAN-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00187-)
    (220..31-)
    (/note="KRAB-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00119"-)
  • Interpro: IPR001909  IPR036051  IPR003309  IPR038269  IPR036236   IPR013087  
  • Prosite: PS50805 PS50804 PS00028 PS50157
  • CDD: cd07765 cd07936
  • STRING: ENSP00000332750
• Other Databases: GeneCards:  ZKSCAN8  Malacards:  ZKSCAN8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881