Search Result
| Gene id | 770 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | CA11 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | CA-RP, CA-RP II, CA-XI, CARP-2, CARPX1 | ||||||||||||||||||||||||||||||||||||
| Gene name | carbonic anhydrase 11 | ||||||||||||||||||||||||||||||||||||
| Alternate names | carbonic anhydrase-related protein 11, carbonic anhydrase XI, carbonic anhydrase-related protein 2, carbonic anhydrase-related protein XI, | ||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.33 (48646186: 48637945) Exons: 6 NC_000019.10 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption |
||||||||||||||||||||||||||||||||||||
| OMIM | 611261 | ||||||||||||||||||||||||||||||||||||
SNPs |
rs7099208 Strand: Allele origin: Allele change: Mutation type: snv NC_000010.11 g.114894815A>G NC_000010.10 g.116654574A>G|SEQ=[A/G]|GENE=FAM160B1 rs13181 Strand: Allele origin: Allele change: Mutation type: snv NC_000019.10 g.45351661T>A NC_000019.10 g.45351661T>G NC_000019.9 g.45854919T>A NC_000019.9 g.45854919T>G NG_007067.2 g.23927A>T NG_007067.2 g.23927A>C NM_000400.4 c.2251A>T NM_000400.4 c.2251A>C NM_000400.3 c.2251A>T NM_000400.3 c.2251A>C XM_0115266 |
||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | O75493 Name: Carbonic anhydrase related protein 11 (CA RP XI) (CA XI) (CARP XI) (Carbonic anhydrase related protein 2) (CA RP II) (CARP 2) Length: 328 Mass: 36238 Tissue specificity: Expressed abundantly in the brain with moderate expression also present in spinal cord and thyroid. | ||||||||||||||||||||||||||||||||||||
| Sequence |
MGAAARLSAPRALVLWAALGAAAHIGPAPDPEDWWSYKDNLQGNFVPGPPFWGLVNAAWSLCAVGKRQSPVDVEL KRVLYDPFLPPLRLSTGGEKLRGTLYNTGRHVSFLPAPRPVVNVSGGPLLYSHRLSELRLLFGARDGAGSEHQIN HQGFSAEVQLIHFNQELYGNFSAASRGPNGLAILSLFVNVASTSNPFLSRLLNRDTITRISYKNDAYFLQDLSLE LLFPESFGFITYQGSLSTPPCSETVTWILIDRALNITSLQMHSLRLLSQNPPSQIFQSLSGNSRPLQPLAHRALR GNRDPRHPERRCRGPNYRLHVDGVPHGR | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CA11  Malacards: CA11 | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||