• Gene id: 7570

Gene Summary

• Gene Symbol: ZNF22   Gene   UCSC   Ensembl
• Aliases: HKR-T1, KOX15, ZNF422, Zfp422
• Gene name: zinc finger protein 22
• Alternate names: zinc finger protein 22, krox-26 protein, zinc finger protein 22 (KOX 15), zinc finger protein KOX15, zinc finger protein Krox-26,
• Gene location: 10q11.21 (45000922: 45005325)     Exons: 4     NC_000010.11
• OMIM: 194529

Protein Summary

• Protein general information: P17026  
  • Name: Zinc finger protein 22 (Zinc finger protein KOX15) (Zinc finger protein Krox 26)
  • Length: 224  
  • Mass: 25915
  • Tissue specificity: In the embryo, expressed in developing craniofacial structures including dental epithelium of maxillary molar tooth organs, tongue epithelium and muscle, and craniofacial bone osteoblasts. In the adult, expressed in mesoderm-derived ti
• Sequence:

  MRLAKPKAGISRSSSQGKAYENKRKTGRQRQKWGMTIRFDSSFSRLRRSLDDKPYKCTECEKSFSQSSTLFQHQK
  IHTGKKSHKCADCGKSFFQSSNLIQHRRIHTGEKPYKCDECGESFKQSSNLIQHQRIHTGEKPYQCDECGRCFSQ
  SSHLIQHQRTHTGEKPYQCSECGKCFSQSSHLRQHMKVHKEEKPRKTRGKNIRVKTHLPSWKAGTGRKSVAGLR

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000298299
• Other Databases: GeneCards:  ZNF22  Malacards:  ZNF22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008270	zinc ion binding	TAS	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0042476	odontogenesis	NAS	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0003677	DNA binding	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881