• Gene id: 747

Gene Summary

• Gene Symbol: DAGLA   Gene   UCSC   Ensembl
• Aliases: C11orf11, DAGL(ALPHA), DAGLALPHA, NSDDR
• Gene name: diacylglycerol lipase alpha
• Alternate names: sn1-specific diacylglycerol lipase alpha, DGL-alpha, neural stem cell-derived dendrite regulator,
• Gene location: 11q12.2 (61680183: 61747001)     Exons: 23     NC_000011.10
• Gene summary(Entrez): This gene encodes a diacylglycerol lipase. The encoded enzyme is involved in the biosynthesis of the endocannabinoid 2-arachidonoyl-glycerol.[provided by RefSeq, Nov 2010]
• OMIM: 602863

Protein Summary

• Protein general information: Q9Y4D2  
  • Name: Sn1 specific diacylglycerol lipase alpha (DGL alpha) (EC 3.1.1. ) (Neural stem cell derived dendrite regulator)
  • Length: 1042  
  • Mass: 114952
  • Tissue specificity: Highly expressed in brain and pancreas. {ECO
• Sequence:

  MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGRGYLGILLSCMIAEMA
  IIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVVCNWVVILSVC
  ITVLCVFDPTGRTFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEF
  FRDLDIVPSDIIAGLVLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKEVCYYMLFAL
  AAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLDENMTAVDIVYTSCHD
  AVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVEGHHGTWLGHKGMVLSAEYIKKKLEQEMVLS
  QAFGRDLGRGTKHYGLIVVGHSLGAGTAAILSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDL
  VPRIGLSQLEGFRRQLLDVLQRSTKPKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLY
  PPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLS
  AAKVMVSPTEVDLTPELIFQQQPLPTGPPMPTGLALELPTADHRNSSVRSKSQSEMSLEGFSEGRLLSPVVAAAA
  RQDPVELLLLSTQERLAAELQARRAPLATMESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDP
  AIPEENPSLSSRTELLAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANDEEEEVGGGGGGPASRGELALHNG
  RLGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILLRAQFEPNLVPKPPRL
  FAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKIRTSTPTGHGASPAKQDELVISAR

• Structural information:
  • Interpro: IPR029058  IPR002921  
  • Prosite: PS00120
  • STRING: ENSP00000257215
• Other Databases: GeneCards:  DAGLA  Malacards:  DAGLA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IBA	biological process
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0046340	diacylglycerol catabolic process	IBA	biological process
GO:0071926	endocannabinoid signaling pathway	IBA	biological process
GO:0098921	retrograde trans-synaptic signaling by endocannabinoid	IBA	biological process
GO:0022008	neurogenesis	IBA	biological process
GO:0042136	neurotransmitter biosynthetic process	IBA	biological process
GO:0042136	neurotransmitter biosynthetic process	IDA	biological process
GO:0046340	diacylglycerol catabolic process	IDA	biological process
GO:0019369	arachidonic acid metabolic process	IDA	biological process
GO:0098839	postsynaptic density membrane	IDA	cellular component
GO:0031901	early endosome membrane	IDA	cellular component
GO:0032590	dendrite membrane	IDA	cellular component
GO:0150077	regulation of neuroinflammatory response	ISS	biological process
GO:0032591	dendritic spine membrane	ISS	cellular component
GO:0098921	retrograde trans-synaptic signaling by endocannabinoid	IMP	biological process
GO:0046340	diacylglycerol catabolic process	IMP	biological process
GO:0098921	retrograde trans-synaptic signaling by endocannabinoid	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0099055	integral component of postsynaptic membrane	IEA	cellular component
GO:0042136	neurotransmitter biosynthetic process	IEA	biological process
GO:0022008	neurogenesis	IEA	biological process
GO:0007405	neuroblast proliferation	IEA	biological process
GO:0098921	retrograde trans-synaptic signaling by endocannabinoid	IEA	biological process
GO:0071926	endocannabinoid signaling pathway	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0043196	varicosity	IEA	cellular component
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0007216	G protein-coupled glutamate receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04723	Retrograde endocannabinoid signaling
hsa04925	Aldosterone synthesis and secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq