• Gene id: 7464

Gene Summary

• Gene Symbol: CORO2A   Gene   UCSC   Ensembl
• Aliases: CLIPINB, IR10, WDR2
• Gene name: coronin 2A
• Alternate names: coronin-2A, WD protein IR10, WD repeat-containing protein 2, WD-repeat protein 2, coronin, actin binding protein, 2A, coronin-like protein B,
• Gene location: 9q22.33 (98192636: 98120974)     Exons: 14     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
• OMIM: 601570

Protein Summary

• Protein general information: Q92828  
  • Name: Coronin 2A (IR10) (WD repeat containing protein 2)
  • Length: 525  
  • Mass: 59763
• Sequence:

  MSWHPQYRSSKFRHVFGKPASKENCYDSVPITRSVHDNHFCAVNPHFIAVVTECAGGGAFLVIPLHQTGKLDPHY
  PKVCGHRGNVLDVKWNPFDDFEIASCSEDATIKIWSIPKQLLTRNLTAYRKELVGHARRVGLVEWHPTAANILFS
  AGYDYKVMIWNLDTKESVITSPMSTISCHQDVILSMSFNTNGSLLATTCKDRKIRVIDPRAGTVLQEASYKGHRA
  SKVLFLGNLKKLMSTGTSRWNNRQVALWDQDNLSVPLMEEDLDGSSGVLFPFYDADTSMLYVVGKGDGNIRYYEV
  SADKPHLSYLTEYRSYNPQKGIGVMPKRGLDVSSCEIFRFYKLITTKSLIEPISMIVPRRSESYQEDIYPPTAGA
  QPSLTAQEWLSGMNRDPILVSLRPGSELLRPHPLPAERPIFNSMAPASPRLLNQTEKLAAEDGWRSSSLLEEKMP
  RWAAEHRLEEKKTWLTNGFDVFECPPPKTENELLQMFYRQQEEIRRLRELLTQREVQAKQLELEIKNLRMGSEQL

• Structural information:
  • Interpro: IPR027335  IPR015505  IPR015048  IPR015943  IPR001680   IPR019775  IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • DIP: 59202
  • STRING: ENSP00000343746
• Other Databases: GeneCards:  CORO2A  Malacards:  CORO2A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051015	actin filament binding	IBA	molecular function
GO:0051015	actin filament binding	IEA	molecular function
GO:0017053	transcription repressor complex	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0017053	transcription repressor complex	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq