• Gene id: 7392

Gene Summary

• Gene Symbol: USF2   Gene   UCSC   Ensembl
• Aliases: FIP, bHLHb12
• Gene name: upstream transcription factor 2, c-fos interacting
• Alternate names: upstream stimulatory factor 2, c-fos interacting protein, class B basic helix-loop-helix protein 12, major late transcription factor 2,
• Gene location: 19q13.12 (35268961: 35279820)     Exons: 12     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the basic helix-loop-helix leucine zipper family of transcription factors. The encoded protein can activate transcription through pyrimidine-rich initiator (Inr) elements and E-box motifs and is involved in regulating multipl
• OMIM: 602372

Protein Summary

• Protein general information: Q15853  
  • Name: Upstream stimulatory factor 2 (Class B basic helix loop helix protein 12) (bHLHb12) (FOS interacting protein) (FIP) (Major late transcription factor 2) (Upstream transcription factor 2)
  • Length: 346  
  • Mass: 36955
  • Tissue specificity: Ubiquitous.
• Sequence:

  MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGG
  QVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGPAAPFPLAVIQNPF
  SNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKI
  DGTRTPRDERRRAQHNEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
  FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ

• Structural information:
  • Protein Domains: (235..29-)
    (/note="bHLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00981"-)
  • Interpro: IPR011598  IPR036638  
  • Prosite: PS50888
  • CDD: cd00083
  • STRING: ENSP00000222305
• Other Databases: GeneCards:  USF2  Malacards:  USF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0046983	protein dimerization activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0007595	lactation	IEA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0055088	lipid homeostasis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000432	positive regulation of transcription from RNA polymerase II promoter by glucose	IEA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0043425	bHLH transcription factor binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0000430	regulation of transcription from RNA polymerase II promoter by glucose	IC	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000432	positive regulation of transcription from RNA polymerase II promoter by glucose	ISS	biological process
GO:0000432	positive regulation of transcription from RNA polymerase II promoter by glucose	IMP	biological process
GO:0055088	lipid homeostasis	ISS	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	molecular function
GO:0019086	late viral transcription	IC	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq