• Gene id: 7366

Gene Summary

• Gene Symbol: UGT2B15   Gene   UCSC   Ensembl
• Aliases: HLUG4, UDPGT 2B8, UDPGT2B15, UDPGTH3, UGT2B8
• Gene name: UDP glucuronosyltransferase family 2 member B15
• Alternate names: UDP-glucuronosyltransferase 2B15, UDP glucuronosyltransferase 2 family, member 15, UDP glucuronosyltransferase 2 family, member B8, UDP glucuronosyltransferase 2 family, polypeptide B15, UDP glycosyltransferase 2B15, UDP gycosyltransferase 2 family, member B15,
• Gene location: 4q13.2 (68670651: 68646596)     Exons: 6     NC_000004.12
• Gene summary(Entrez): This gene encodes a glycosyltransferase that is invovled in the metabolism and elimination of toxic compounts, both endogenous and of xenobiotic origin. This gene plays a role in the regulation of estrogens and androgens. This locus is present in a cluste
• OMIM: 600069

Protein Summary

• Protein general information: P54855  
  • Name: UDP glucuronosyltransferase 2B15 (UDPGT 2B15) (EC 2.4.1.17) (HLUG4) (UDP glucuronosyltransferase 2B8) (UDPGT 2B8) (UDPGTh 3)
  • Length: 530  
  • Mass: 61036
  • Tissue specificity: Expressed in many tissues. Present in liver, prostate and testis. {ECO
• Sequence:

  MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLE
  VYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVIL
  ADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWF
  QIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSS
  GENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITH
  GGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIH
  HDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGK
  KKKRD

• Structural information:
  • Interpro: IPR002213  IPR035595  
  • Prosite: PS00375
  • PDB: 6IPB
  • PDBsum: 6IPB
  • STRING: ENSP00000341045
• Other Databases: GeneCards:  UGT2B15  Malacards:  UGT2B15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0008194	UDP-glycosyltransferase activity	IBA	molecular function
GO:0008194	UDP-glycosyltransferase activity	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0008202	steroid metabolic process	TAS	biological process
GO:0006805	xenobiotic metabolic process	TAS	biological process
GO:0015020	glucuronosyltransferase activity	IEA	molecular function
GO:0015020	glucuronosyltransferase activity	IDA	molecular function
GO:0001972	retinoic acid binding	IDA	NOT|molecular function
GO:0052695	cellular glucuronidation	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0052695	cellular glucuronidation	IDA	biological process
GO:0015020	glucuronosyltransferase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa00830	Retinol metabolism
hsa00140	Steroid hormone biosynthesis
hsa00860	Porphyrin and chlorophyll metabolism
hsa00040	Pentose and glucuronate interconversions
hsa00053	Ascorbate and aldarate metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)