• Gene id: 7355

Gene Summary

• Gene Symbol: SLC35A2   Gene   UCSC   Ensembl
• Aliases: CDG2M, CDGX, UDP-Gal-Tr, UGALT, UGAT, UGT, UGT1, UGT2, UGTL
• Gene name: solute carrier family 35 member A2
• Alternate names: UDP-galactose translocator, solute carrier family 35 (UDP-galactose transporter), member 2, solute carrier family 35 (UDP-galactose transporter), member A2,
• Gene location: Xp11.23 (48911957: 48903182)     Exons: 6     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the nucleotide-sugar transporter family. The encoded protein is a multi-pass membrane protein. It transports UDP-galactose from the cytosol into Golgi vesicles, where it serves as a glycosyl donor for the generation of glycan
• OMIM: 606383

Protein Summary

• Protein general information: P78381  
  • Name: UDP galactose translocator (Solute carrier family 35 member A2) (UDP galactose transporter) (UDP Gal Tr) (UGT)
  • Length: 396  
  • Mass: 41307
• Sequence:

  MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTLPGDRFFATTAVVMAE
  VLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKIL
  TTALFSVLMLNRSLSRLQWASLLLLFTGVAIVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILK
  GSSGSVWLRNLQLGLFGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFA
  TSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCVHQQPPGQPPPPQLSS
  HRGDLITEPFLPKLLTKVKGS

• Structural information:
  • Interpro: IPR007271  
  • STRING: ENSP00000416002
• Other Databases: GeneCards:  SLC35A2  Malacards:  SLC35A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005459	UDP-galactose transmembrane transporter activity	IBA	molecular function
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0030173	integral component of Golgi membrane	IBA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0015165	pyrimidine nucleotide-sugar transmembrane transporter activity	IEA	molecular function
GO:0090481	pyrimidine nucleotide-sugar transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005459	UDP-galactose transmembrane transporter activity	TAS	molecular function
GO:0006012	galactose metabolic process	TAS	biological process
GO:0072334	UDP-galactose transmembrane transport	TAS	biological process
GO:0005459	UDP-galactose transmembrane transporter activity	TAS	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Early infantile epileptic encephalopathy	KEGG:H00606
Congenital disorders of glycosylation type II	KEGG:H00119
Early infantile epileptic encephalopathy	KEGG:H00606
Congenital disorders of glycosylation type II	KEGG:H00119
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray