• Gene id: 7288

Gene Summary

• Gene Symbol: TULP2   Gene   UCSC   Ensembl
• Aliases: CT65, TUBL2
• Gene name: TUB like protein 2
• Alternate names: tubby-related protein 2, cancer testis antigen 65, tubby like protein 2,
• Gene location: 19q13.33 (48900220: 48880816)     Exons: 15     NC_000019.10
• Gene summary(Entrez): TULP2 is a member of a family of tubby-like genes (TULPs) that encode proteins of unknown function. Members of this family have been identified in plants, vertebrates, and invertebrates. The TULP proteins share a conserved C-terminal region of approximate
• OMIM: 602309

Protein Summary

• Protein general information: O00295  
  • Name: Tubby related protein 2 (Cancer/testis antigen 65) (CT65) (Tubby like protein 2)
  • Length: 520  
  • Mass: 58664
  • Tissue specificity: Strongly expressed in testis. Also expressed in retina. Expressed in cancer cell lines. {ECO
• Sequence:

  MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANPDASPWLWRSCLREERLLGDRGLGNP
  FLRKKVSEAHLPSGIHSALGTVSCGGDGRGERGLPTPRTEAVFRNLGLQSPFLSWLPDNSDAELEEVSVENGSVS
  PPPFKQSPRIRRKGWQAHQRPGTRAEGESDSQDMGDAHKSPNMGPNPGMDGDCVYENLAFQKEEDLEKKREASES
  TGTNSSAAHNEELSKALKGEGGTDSDHMRHEASLAIRSPCPGLEEDMEAYVLRPALPGTMMQCYLTRDKHGVDKG
  LFPLYYLYLETSDSLQRFLLAGRKRRRSKTSNYLISLDPTHLSRDGDNFVGKVRSNVFSTKFTIFDNGVNPDREH
  LTRNTARIRQELGAVCYEPNVLGYLGPRKMTVILPGTNSQNQRINVQPLNEQESLLSRYQRGDKQGLLLLHNKTP
  SWDKENGVYTLNFHGRVTRASVKNFQIVDPKHQEHLVLQFGRVGPDTFTMDFCFPFSPLQAFSICLSSFN

• Structural information:
  • Interpro: IPR025659  IPR000007  IPR018066  IPR005398  
  • Prosite: PS01200
  • STRING: ENSP00000221399
• Other Databases: GeneCards:  TULP2  Malacards:  TULP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061512	protein localization to cilium	IBA	biological process
GO:0005929	cilium	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007601	visual perception	TAS	biological process
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray