• Gene id: 728224

Gene Summary

• Gene Symbol: KRTAP4-8   Gene   UCSC   Ensembl
• Aliases: KAP4.8, KRTAP4.8
• Gene name: keratin associated protein 4-8
• Alternate names: keratin-associated protein 4-8, keratin associated protein 4.8, ultrahigh sulfur keratin-associated protein 4.8,
• Gene location: 17q21.2 (41098141: 41096980)     Exons: 1     NC_000017.11

Protein Summary

• Protein general information: Q9BYQ9  
  • Name: Keratin associated protein 4 8 (Keratin associated protein 4.8) (Ultrahigh sulfur keratin associated protein 4.8)
  • Length: 185  
  • Mass: 19627
  • Tissue specificity: Expressed in the hair follicles. {ECO
• Sequence:

  MVNSCCGSVCSDQGCGQDLCQETCCCPSCCQTTCCRTTCYRPSYSVSCCCRPQCCQSVCCQPTCCRPSCCVSSCC
  KPQCCQSVCCQPTCCHPSCCISSCCRPSCCVSSCCKPQCCQSVCCQPNCCRPSCSISSCCRPSCCESSCCRPCCC
  LRPVCGRVSCHTTCYRPACVISTCPRPVCCASSCC

• Structural information:
  • Interpro: IPR002494  
  • STRING: ENSP00000328444
• Other Databases: GeneCards:  KRTAP4-8  Malacards:  KRTAP4-8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045095	keratin filament	IEA	cellular component
GO:0005882	intermediate filament	IEA	cellular component
GO:0031424	keratinization	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042633	hair cycle	IDA	biological process
GO:0007568	aging	IDA	biological process

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq