• Gene id: 7275

Gene Summary

• Gene Symbol: TUB   Gene   UCSC   Ensembl
• Aliases: RDOB, rd5
• Gene name: TUB bipartite transcription factor
• Alternate names: tubby protein homolog, tubby bipartite transcription factor, tubby homolog, tubby homologue,
• Gene location: 11p15.4 (8019179: 8106242)     Exons: 16     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as

Protein Summary

• Protein general information: P50607  
  • Name: Tubby protein homolog
  • Length: 506  
  • Mass: 55651
• Sequence:

  MTSKPHSDWIPYSVLDDEGRNLRQQKLDRQRALLEQKQKKKRQEPLMVQANADGRPRSRRARQSEEQAPLVESYL
  SSSGSTSYQVQEADSLASVQLGATRPTAPASAKRTKAAATAGGQGGAARKEKKGKHKGTSGPAALAEDKSEAQGP
  VQILTVGQSDHAQDAGETAAGGGERPSGQDLRATMQRKGISSSMSFDEDEEDEEENSSSSSQLNSNTRPSSATSR
  KSVREAASAPSPTAPEQPVDVEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMYPTYFLHLDREDGKKVFLLA
  GRKRKKSKTSNYLISVDPTDLSRGGDSYIGKLRSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETN
  VLGFKGPRKMSVIVPGMNMVHERVSIRPRNEHETLLARWQNKNTESIIELQNKTPVWNDDTQSYVLNFHGRVTQA
  SVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE

• Structural information:
  • Interpro: IPR025659  IPR000007  IPR018066  IPR005398  
  • Prosite: PS01200 PS01201
  • PDB: 1S31
  • PDBsum: 1S31
  • STRING: ENSP00000305426
• Other Databases: GeneCards:  TUB  Malacards:  TUB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061512	protein localization to cilium	IBA	biological process
GO:0005929	cilium	IBA	cellular component
GO:0006909	phagocytosis	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0050896	response to stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0042073	intraciliary transport	IDA	biological process
GO:0001664	G protein-coupled receptor binding	IDA	molecular function
GO:0120160	intraciliary transport particle A binding	IDA	molecular function
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005929	cilium	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0009725	response to hormone	IEA	biological process
GO:0097500	receptor localization to non-motile cilium	IEA	biological process
GO:0061512	protein localization to cilium	IEA	biological process
GO:0007605	sensory perception of sound	IEA	biological process
GO:1903546	protein localization to photoreceptor outer segment	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0045494	photoreceptor cell maintenance	IEA	biological process
GO:0008277	regulation of G protein-coupled receptor signaling pathway	IEA	biological process
GO:0006910	phagocytosis, recognition	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0050766	positive regulation of phagocytosis	IDA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq