• Gene id: 7268

Gene Summary

• Gene Symbol: TTC4   Gene   UCSC   Ensembl
• Aliases: CNS1
• Gene name: tetratricopeptide repeat domain 4
• Alternate names: tetratricopeptide repeat protein 4, TPR repeat protein 4,
• Gene location: 1p32.3 (54715821: 54742656)     Exons: 10     NC_000001.11
• Gene summary(Entrez): This gene encodes a protein that contains tetratricopeptide (TPR) repeats, which often mediate protein-protein interactions and chaperone activity. The encoded protein interacts with heat shock proteins 70 and 90. Alternative splicing results in multiple
• OMIM: 606753

Protein Summary

• Protein general information: O95801  
  • Name: Tetratricopeptide repeat protein 4 (TPR repeat protein 4)
  • Length: 387  
  • Mass: 44679
  • Tissue specificity: Highly expressed in proliferating tissue and tumor cell lines but not in normal cell lines. {ECO
• Sequence:

  MEQPGQDPTSDDVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDPRENPDLACLQSIIFDEERSP
  EEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADPDLNAVLYTNRAAAQYYLGNFRSALNDVTAARKLKPCH
  LKAIIRGALCHLELKHFAEAVNWCDEGLQIDAKEKKLLEMRAKADKLKRIEQRDVRKANLKEKKERNQNEALLQA
  IKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLSWPVLFLYPEYAQSDFISAFHEDSRF
  IDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRVPAKSTLLQVLQHQRYFVKALTPAFLVCVGSSPFCK
  NFLRGRKVYQIR

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR019734  
  • Prosite: PS50293
  • PDB: 6HFO
  • PDBsum: 6HFO
  • STRING: ENSP00000360329
• Other Databases: GeneCards:  TTC4  Malacards:  TTC4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0045087	innate immune response	IMP	biological process
GO:0051607	defense response to virus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051607	defense response to virus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)