• Gene id: 723961

Gene Summary

• Gene Symbol: INS-IGF2   Gene   UCSC   Ensembl
• Aliases: INSIGF
• Gene name: INS-IGF2 readthrough
• Alternate names: insulin, isoform 2, INS-IGF2 readthrough transcript protein, insulin- insulin-like growth factor 2 read-through product,
• Gene location: 11p15.5 (2161208: 2129116)     Exons: 8     NC_000011.10
• Gene summary(Entrez): This locus includes two alternatively spliced read-through transcript variants which align to the INS gene in the 5' region and to the IGF2 gene in the 3' region. One transcript is predicted to encode a protein which shares the N-terminus with the INS pro
• OMIM: 601197

Protein Summary

• Protein general information: F8WCM5  
  • Name: Insulin, isoform 2 (INS IGF2 readthrough transcript protein)
  • Length: 200  
  • Mass: 21537
  • Tissue specificity: Expressed in pancreas, eye and, to a lower extent, in limb. {ECO
• Sequence:

  MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQASALSLSSSTSTW
  PEGLDATARAPPALVVTANIGQAGGSSSRQFRQRALGTSDSPVLFIHCPGAAGTAQGLEYRGRRVTTELVWEEVD
  SSPQPQGSESLPAQPPAQPAPQPEPQQAREPSPEVSCCGLWPRRPQRSQN

• Structural information:
  • Interpro: IPR004825  IPR016179  IPR036438  
  • STRING: ENSP00000380440
• Other Databases: GeneCards:  INS-IGF2  Malacards:  INS-IGF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray