• Gene id: 7173

Gene Summary

• Gene Symbol: TPO   Gene   UCSC   Ensembl
• Aliases: MSA, TDH2A, TPX
• Gene name: thyroid peroxidase
• Alternate names: thyroid peroxidase, thyroid microsomal antigen, thyroperoxidase,
• Gene location: 2p25.3 (91867535: 91779745)     Exons: 13     NC_000014.9
• Gene summary(Entrez): This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pa
• OMIM: 606765

Protein Summary

• Protein general information: P07202  
  • Name: Thyroid peroxidase (TPO) (EC 1.11.1.8)
  • Length: 933  
  • Mass: 102963
• Sequence:

  MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLS
  FSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALSEDLLSIIANMSGCLPYMLPPKCPNTCLANK
  YRPITGACNNRDHPRWGASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDR
  YSDLLMAWGQYIDHDIAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
  QGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSGRAYLPFVPPRAPAAC
  APEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAALKALNAHWSADAVYQEARKVVGALHQIITL
  RDYIPRILGPEAFQQYVGPYEGYDSTANPTVSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFS
  PWTLLRGGGLDPLIRGLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
  PRLETPADLSTAIASRSVADKILDLYKHPDNIDVWLGGLAENFLPRARTGPLFACLIGKQMKALRDGDWFWWENS
  HVFTDAQRRELEKHSLSRVICDNTGLTRVPMDAFQVGKFPEDFESCDSITGMNLEAWRETFPQDDKCGFPESVEN
  GDFVHCEESGRRVLVYSCRHGYELQGREQLTCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLC
  ADPYELGDDGRTCVDSGRLPRVTWISMSLAALLIGGFAGLTSTVICRWTRTGTKSTLPISETGGGTPELRCGKHQ
  AVGTSPQRAAAQDSEQESAGMEGRDTHRLPRAL

• Structural information:
  • Protein Domains: (740..79-)
    (/note="Sushi-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00302-)
    (796..83-)
    (/note="EGF-lik-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076"-)
  • Interpro: IPR001881  IPR013032  IPR000742  IPR000152  IPR018097   IPR019791  IPR010255  IPR037120  IPR035976  IPR000436  IPR029589  
  • Prosite: PS00010 PS01186 PS50026 PS01187 PS00435 PS50292 PS50923
  • CDD: cd00033
  • STRING: ENSP00000318820
• Other Databases: GeneCards:  TPO  Malacards:  TPO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0004601	peroxidase activity	IBA	molecular function
GO:0035162	embryonic hemopoiesis	IDA	biological process
GO:0004601	peroxidase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004447	iodide peroxidase activity	IEA	molecular function
GO:0006590	thyroid hormone generation	IEA	biological process
GO:0006979	response to oxidative stress	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042446	hormone biosynthetic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042744	hydrogen peroxide catabolic process	IEA	biological process
GO:0004601	peroxidase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0004447	iodide peroxidase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006590	thyroid hormone generation	TAS	biological process
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004601	peroxidase activity	TAS	molecular function
GO:0004601	peroxidase activity	TAS	molecular function
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0006590	thyroid hormone generation	IEA	biological process
GO:0005615	extracellular space	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04918	Thyroid hormone synthesis
hsa00350	Tyrosine metabolism
hsa05320	Autoimmune thyroid disease

Diseases

Associated diseases	References
Thyroid dyshormonogenesis	KEGG:H00251
Thyroid dyshormonogenesis	KEGG:H00251
Congenital hypothyroidism	PMID:7550241
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq