|
Gene id |
7165 |
| Gene Summary Protein Summary Gene ontology Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
TPD52L2 Gene UCSC Ensembl |
|
Aliases |
D54, TPD54 |
|
Gene name |
TPD52 like 2 |
|
Alternate names |
tumor protein D54, HCCR-binding protein 2, tumor protein D52 like 2, |
|
Gene location |
20q13.33 (63865227: 63891544) Exons: 2 NC_000020.11
|
|
Gene summary(Entrez) |
This gene encodes a member of the tumor protein D52-like family. These proteins are characterized by an N-terminal coiled-coil motif that is used to form homo- and heteromeric complexes with other tumor protein D52-like proteins. Expression of this gene m
|
|
OMIM |
603747 |
Protein Summary
|
| Protein general information
| O43399
Name: Tumor protein D54 (hD54) (Tumor protein D52 like 2)
Length: 206 Mass: 22238
|
| Sequence |
MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCG ELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSA ISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
|
| Structural information |
|
| Other Databases |
GeneCards: TPD52L2  Malacards: TPD52L2 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0003824 |
catalytic activity
|
IEA |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0003723 |
RNA binding
|
HDA |
molecular function |
|
|
| Associated diseases |
References |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|