• Gene id: 71241

Gene Summary

• Gene Symbol: Dmrtc2   Gene   UCSC   Ensembl
• Aliases: 4933432E21Rik, Dmrt7
• Gene name: doublesex and mab-3 related transcription factor like family C2
• Alternate names: doublesex- and mab-3-related transcription factor C2, doublesex and mab-3 related transcription factor 7,
• Gene location: 7 A3 (24869816: 24877654)     Exons: 11     NC_000073.6

Protein Summary

• Protein general information: Q8CGW9  
  • Name: Doublesex and mab 3 related transcription factor C2 (Doublesex and mab 3 related transcription factor 7)
  • Length: 370  
  • Mass: 39095
  • Tissue specificity: Expressed in testis. Highly expressed in ovary.
• Sequence:

  MDPSETAALHHCSADSSPADEARVPQSTELIPRRPVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLIL
  ERRRVMAAQVALRRQQEAQLKRHLAQGLMKGATPLKAPLRVKKGAIRPGIPSGKENIAPQPQSPHGAVPLVLTPP
  GKENYGPLLLSRPPEALPLPWTPVPPGPWGPGHWLPPGLSMPPPVVCRLLCQEPAVPLHPFPGFDPGTSLRLPTH
  GTLPTCPGSRSVLTAPLSGEPQGPPNLPHTCSTLILQSCGTPDSLLLQPQAPGASCLAWTSGPSERQLQREAAEA
  LVGLKDSSQAPRLTPSVPPNPAWISLLHPCGPPAPPGGRGFQPVGPPLRPSPGSSVSLHIGRLGSISLLS

• Structural information:
  • Interpro: IPR001275  IPR036407  IPR031577  IPR026607  
  • Prosite: PS40000 PS50809
  • STRING: ENSMUSP00000011493
• Other Databases: GeneCards:  Dmrtc2  Malacards:  Dmrtc2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0007548	sex differentiation	IEA	biological process
GO:0043565	sequence-specific DNA binding	IDA	molecular function
GO:0001741	XY body	IDA	cellular component
GO:1900114	positive regulation of histone H3-K9 trimethylation	IMP	biological process
GO:1900111	positive regulation of histone H3-K9 dimethylation	IMP	biological process
GO:0007290	spermatid nucleus elongation	IMP	biological process
GO:0007141	male meiosis I	IMP	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Associated with spermatocyte-specific translation	MIK: 18391541

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18391541	Associated with spermatocyte-specific translation				Male infertility