• Gene id: 7103

Gene Summary

• Gene Symbol: TSPAN8   Gene   UCSC   Ensembl
• Aliases: CO-029, TM4SF3
• Gene name: tetraspanin 8
• Alternate names: tetraspanin-8, transmembrane 4 superfamily member 3, tspan-8, tumor-associated antigen CO-029,
• Gene location: 12q21.1 (71157998: 71125092)     Exons: 10     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate
• OMIM: 600769

Protein Summary

• Protein general information: P19075  
  • Name: Tetraspanin 8 (Tspan 8) (Transmembrane 4 superfamily member 3) (Tumor associated antigen CO 029)
  • Length: 237  
  • Mass: 26044
  • Tissue specificity: Gastric, colon, rectal, and pancreatic carcinomas.
• Sequence:

  MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCC
  GAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFK
  CCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLV
  FSMVLYCQIGNK

• Structural information:
  • Interpro: IPR000301  IPR018499  IPR018503  IPR008952  
  • Prosite: PS00421
  • STRING: ENSP00000377003
• Other Databases: GeneCards:  TSPAN8  Malacards:  TSPAN8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007283	spermatogenesis	IEA	biological process
GO:0030195	negative regulation of blood coagulation	IEA	biological process
GO:0005178	integrin binding	IEA	molecular function
GO:0010468	regulation of gene expression	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)