• Gene id: 7060

Gene Summary

• Gene Symbol: THBS4   Gene   UCSC   Ensembl
• Aliases: TSP-4, TSP4
• Gene name: thrombospondin 4
• Alternate names: thrombospondin-4,
• Gene location: 5q14.1 (79991295: 80083752)     Exons: 27     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the thrombospondin protein family. Thrombospondin family members are adhesive glycoproteins that mediate cell-to-cell and cell-to-matrix interactions. This protein forms a pentamer and can bind to heparin and ca
• OMIM: 603409

Protein Summary

• Protein general information: P35443  
  • Name: Thrombospondin 4
  • Length: 961  
  • Mass: 105869
• Sequence:

  MLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYVISTFKLQTKSSATIF
  GLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLADGRRHRILLRLSNLQRGAGSLELYLDCIQV
  DSVHNLPRAFAGPSQKPETIELRTFQRKPQDFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLG
  QMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
  CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVHCINLSPGFRCDACPVGFTGPMVQGVGISFAKSNKQ
  VCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKAERNCRNPELNPCSVNAQCIEERQGDVTCVC
  GVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVL
  IHNVDQRNSDKDIFGDACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGD
  ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDL
  VPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNW
  VVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATP
  FRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
  GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFDN

• Structural information:
  • Protein Domains: (27..19-)
    (/note="Laminin-G-like)
    (286..32-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (326..36-)
    (/note="EGF-like-)
    (-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (379..41-)
    (/-)
  • Interpro: IPR013320  IPR001881  IPR013032  IPR000742  IPR018097   IPR001791  IPR024665  IPR003367  IPR017897  IPR008859  IPR028974  
  • Prosite: PS01186 PS50026 PS01187 PS51234 PS51236
  • STRING: ENSP00000339730
• Other Databases: GeneCards:  THBS4  Malacards:  THBS4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0062023	collagen-containing extracellular matrix	IBA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IBA	biological process
GO:0034103	regulation of tissue remodeling	ISS	biological process
GO:0062023	collagen-containing extracellular matrix	ISS	cellular component
GO:0016529	sarcoplasmic reticulum	ISS	cellular component
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0048266	behavioral response to pain	ISS	biological process
GO:0034976	response to endoplasmic reticulum stress	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0048771	tissue remodeling	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0006986	response to unfolded protein	IEA	biological process
GO:0007155	cell adhesion	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005576	extracellular region	TAS	cellular component
GO:0062023	collagen-containing extracellular matrix	IEA	cellular component
GO:0034103	regulation of tissue remodeling	IEA	biological process
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0048266	behavioral response to pain	IEA	biological process
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016529	sarcoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005604	basement membrane	IDA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0071603	endothelial cell-cell adhesion	IDA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005509	calcium ion binding	IDA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0090023	positive regulation of neutrophil chemotaxis	IDA	biological process
GO:0051451	myoblast migration	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0001938	positive regulation of endothelial cell proliferation	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0016525	negative regulation of angiogenesis	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05165	Human papillomavirus infection
hsa04510	Focal adhesion
hsa04145	Phagosome
hsa04512	ECM-receptor interaction
hsa05144	Malaria

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881