|
Gene id |
7032 |
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
TFF2 Gene UCSC Ensembl |
|
Aliases |
SML1, SP |
|
Gene name |
trefoil factor 2 |
|
Alternate names |
trefoil factor 2, spasmolysin, spasmolytic polypeptide, spasmolytic protein 1, |
|
Gene location |
21q22.3 (42350993: 42346356) Exons: 4 NC_000021.9
|
|
Gene summary(Entrez) |
Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are
|
|
OMIM |
182590 |
Protein Summary
|
| Protein general information
| Q03403
Name: Trefoil factor 2 (Spasmolysin) (Spasmolytic polypeptide) (SP)
Length: 129 Mass: 14284
Tissue specificity: Stomach.
|
| Sequence |
MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPK QESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
|
| Structural information |
|
| Other Databases |
GeneCards: TFF2  Malacards: TFF2 |
|
| GO accession | Term name | Evidence code | Go category |
|---|
| GO:0005615 |
extracellular space
|
IBA |
cellular component |
GO:0031723 |
CXCR4 chemokine receptor binding
|
IBA |
molecular function |
GO:0060455 |
negative regulation of ga stric acid secretion
|
IBA |
biological process |
GO:0070098 |
chemokine-mediated signal ing pathway
|
IBA |
biological process |
GO:0030277 |
maintenance of gastrointe stinal epithelium
|
IBA |
biological process |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
GO:0005515 |
protein binding
|
IPI |
molecular function |
GO:0005576 |
extracellular region
|
IEA |
cellular component |
|
|
| Pathway id | Pathway name |
| P06959 | CCKR signaling map | | P06959 | CCKR signaling map | |
|
| Associated diseases |
References |
| Prostate cancer | PMID:16467092 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
|