• Gene id: 6944

Gene Summary

• Gene Symbol: VPS72   Gene   UCSC   Ensembl
• Aliases: CFL1, Swc2, TCFL1, YL-1, YL1
• Gene name: vacuolar protein sorting 72 homolog
• Alternate names: vacuolar protein sorting-associated protein 72 homolog, transcription factor-like 1, transformation suppressor gene YL-1,
• Gene location: 1q21.3 (151190209: 151176303)     Exons: 6     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a shared subunit of two multi-component complexes, the histone acetyltransferase complex TRRAP/TIP60 as well as the chromatin remodeling SRCAP-containing complex. The TRRAP/TIP60 complex acetylates nucleosomal histones
• OMIM: 605002

Protein Summary

• Protein general information: Q15906  
  • Name: Vacuolar protein sorting associated protein 72 homolog (Protein YL 1) (Transcription factor like 1)
  • Length: 364  
  • Mass: 40594
• Sequence:

  MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGEA
  EEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPLELQDDGSDSRKSMRQSTAEHTRQTFLRVQE
  RQGQSRRRKGPHCERPLTQEELLREAKITEELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEP
  GPKEENVDIEGLDPAPSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPAL
  YRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLPGSGPRALRQKIVIK

• Structural information:
  • Interpro: IPR008895  IPR013272  
  • PDB: 5FUG
  • PDBsum: 5FUG
  • DIP: 31767
  • STRING: ENSP00000346464
• Other Databases: GeneCards:  VPS72  Malacards:  VPS72

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0043486	histone exchange	IBA	biological process
GO:0042393	histone binding	IPI	molecular function
GO:0043486	histone exchange	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006338	chromatin remodeling	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0043486	histone exchange	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	TAS	biological process
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0035019	somatic stem cell population maintenance	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881