Search Result
| Gene id | 689 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | BTF3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | BETA-NAC, BTF3a, BTF3b, NACB | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | basic transcription factor 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | transcription factor BTF3, NAC-beta, RNA polymerase B transcription factor 3, nascent polypeptide-associated complex subunit beta, nascent-polypeptide-associated complex beta polypeptide, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
5q13.2 (41440982: 41436153) Exons: 7 NC_000017.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes the basic transcription factor 3. This protein forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 602542 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SNPs |
rs508485 Strand: Allele origin: Allele change: Mutation type: snv NC_000011.10 g.94621313C>T NC_000011.9 g.94354479C>T NM_152431.3 c.*321C>T NM_152431.2 c.*321C>T|SEQ=[C/T]|GENE=PIWIL4 LOC105369438 105369438 rs7110167 Strand: Allele origin: Allele change: Mutation type: snv NC_000011.10 g.94587071T>C NC_000011.9 g.94320237T>C NM_152431.3 c.738T>C NM_152431.2 c.738T>C|SEQ=[T/C]|GENE=PIWIL4 LOC105369438 105369438 rs57607909 Strand: Allele origin: Allele change: Mutation type: snv NC_000011.10 g.94593599G>C NC_000011.9 g.94326765G>C NM_152431.3 c.1108G>C NM_152431.2 c.1108G>C NP_689644.2 p.Ala370Pro|SEQ=[G/C]|GENE=PIWIL4 LOC105369438 105369438 rs593690 Strand: Allele origin: Allele change: Mutation type: snv NC_000011.10 g.94604054C>A NC_000011.10 g.94604054C>T NC_000011.9 g.94337220C>A NC_000011.9 g.94337220C>T NM_152431.3 c.1636C>A NM_152431.3 c.1636C>T NM_152431.2 c.1636C>A NM_152431.2 c.1636C>T NP_689644.2 p.Leu546Met|SEQ=[C/A/T]|GENE=PIWIL4 L |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P20290 Name: Transcription factor BTF3 (Nascent polypeptide associated complex subunit beta) (NAC beta) (RNA polymerase B transcription factor 3) Length: 206 Mass: 22168 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MRRTGAPAQADSRGRGRARGGCPGGEATLSQPPPRGGTRGQEPQMKETIMNQEKLAKLQAQVRIGGKGTARRKKK VVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSI LNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLVENFDEASKNEAN | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: BTF3  Malacards: BTF3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||