• Gene id: 688

Gene Summary

• Gene Symbol: KLF5   Gene   UCSC   Ensembl
• Aliases: BTEB2, CKLF, IKLF
• Gene name: Kruppel like factor 5
• Alternate names: Krueppel-like factor 5, (intestinal Kruppel-like factor, BTE-binding protein 2, GC box binding protein 2, Klf5C isoform, Kruppel-like factor 5 (intestinal), basic transcription element binding protein 2, colon krueppel-like factor, colon kruppel-like factor, epidi,
• Gene location: 13q22.1 (73054975: 73077541)     Exons: 5     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the Kruppel-like factor subfamily of zinc finger proteins. The encoded protein is a transcriptional activator that binds directly to a specific recognition motif in the promoters of target genes. This protein acts downstream
• OMIM: 602903

Protein Summary

• Protein general information: Q13887  
  • Name: Krueppel like factor 5 (Basic transcription element binding protein 2) (BTE binding protein 2) (Colon krueppel like factor) (GC box binding protein 2) (Intestinal enriched krueppel like factor) (Transcription factor BTEB2)
  • Length: 457  
  • Mass: 50792
  • Tissue specificity: Expressed only in testis and placenta.
• Sequence:

  MATRVLSMSARLGPVPQPPAPQDEPVFAQLKPVLGAANPARDAALFPGEELKHAHHRPQAQPAPAQAPQPAQPPA
  TGPRLPPEDLVQTRCEMEKYLTPQLPPVPIIPEHKKYRRDSASVVDQFFTDTEGLPYSINMNVFLPDITHLRTGL
  YKSQRPCVTHIKTEPVAIFSHQSETTAPPPAPTQALPEFTSIFSSHQTAAPEVNNIFIKQELPTPDLHLSVPTQQ
  GHLYQLLNTPDLDMPSSTNQTAAMDTLNVSMSAAMAGLNTHTSAVPQTAVKQFQGMPPCTYTMPSQFLPQQATYF
  PPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPTTLPVNSQNIQPVRYNRRSNPDLEKRRIHYC
  DYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLAL
  HMKRHQN

• Structural information:
  • Interpro: IPR030401  IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • PDB: 2EBT
  • PDBsum: 2EBT
  • STRING: ENSP00000366915
• Other Databases: GeneCards:  KLF5  Malacards:  KLF5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0014816	skeletal muscle satellite cell differentiation	IEA	biological process
GO:0014908	myotube differentiation involved in skeletal muscle regeneration	IEA	biological process
GO:0032534	regulation of microvillus assembly	IEA	biological process
GO:0043403	skeletal muscle tissue regeneration	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0061586	positive regulation of transcription by transcription factor localization	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0014901	satellite cell activation involved in skeletal muscle regeneration	IEA	biological process
GO:0030033	microvillus assembly	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0043426	MRF binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0060576	intestinal epithelial cell development	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:1901653	cellular response to peptide	IEA	biological process
GO:0099156	cell-cell signaling via exosome	IDA	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)