• Gene id: 6836

Gene Summary

• Gene Symbol: SURF4   Gene   UCSC   Ensembl
• Aliases: ERV29
• Gene name: surfeit 4
• Alternate names: surfeit locus protein 4, surface 4 integral membrane protein,
• Gene location: 9q34.2 (133377948: 133361448)     Exons: 11     NC_000009.12
• Gene summary(Entrez): This gene is located in the surfeit gene cluster, which is comprised of very tightly linked housekeeping genes that do not share sequence similarity. The encoded protein is a conserved integral membrane protein that interacts with endoplasmic reticulum-Go
• OMIM: 185660

Protein Summary

• Protein general information: O15260  
  • Name: Surfeit locus protein 4
  • Length: 269  
  • Mass: 30394
• Sequence:

  MGQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASSFVFLNLL
  GQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAESRSEGKSMFAGVPTMRE
  SSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIGFKTKLAALTLVVWLFAINVYFNAFWTI
  PVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMDEKKKEW

• Structural information:
  • Interpro: IPR002995  
  • Prosite: PS01339
  • STRING: ENSP00000361057
• Other Databases: GeneCards:  SURF4  Malacards:  SURF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component
GO:0034498	early endosome to Golgi transport	IMP	NOT|biological process
GO:0010638	positive regulation of organelle organization	IMP	biological process
GO:0032527	protein exit from endoplasmic reticulum	IMP	NOT|biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0033116	endoplasmic reticulum-Golgi intermediate compartment membrane	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray