• Gene id: 6835

Gene Summary

• Gene Symbol: SURF2   Gene   UCSC   Ensembl
• Aliases: SURF-2
• Gene name: surfeit 2
• Alternate names: surfeit locus protein 2,
• Gene location: 9q34.2 (133356549: 133361157)     Exons: 6     NC_000009.12
• Gene summary(Entrez): This gene shares a bidirectional promoter with surfeit 1 (SURF1; GeneID: 6834), which is located on the opposite strand. It encodes a conserved protein that is expressed in a variety of tissues. [provided by RefSeq, Jul 2013]
• OMIM: 185630

Protein Summary

• Protein general information: Q15527  
  • Name: Surfeit locus protein 2 (Surf 2)
  • Length: 256  
  • Mass: 29648
• Sequence:

  MSELPGDVRAFLREHPSLRLQTDARKVRCILTGHELPCRLPELQVYTRGKKYQRLVRASPAFDYAEFEPHIVPST
  KNPHQLFCKLTLRHINKCPEHVLRHTQGRRYQRALCKYEECQKQGVEYVPACLVHRRRRREDQMDGDGPRPREAF
  WEPTSSDEGGAASDDSMTDLYPPELFTRKDLGSTEDGDGTDDFLTDKEDEKAKPPREKATDESRRETTVYRGLVQ
  KRGKKQLGSLKKKFKSHHRKPKSFSSCKQPG

• Structural information:
  • STRING: ENSP00000361032
• Other Databases: GeneCards:  SURF2  Malacards:  SURF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray