• Gene id: 6775

Gene Summary

• Gene Symbol: STAT4   Gene   UCSC   Ensembl
• Aliases: SLEB11
• Gene name: signal transducer and activator of transcription 4
• Alternate names: signal transducer and activator of transcription 4, signal transducer and activator of transcription 4 variant 3,
• Gene location: 2q32.2-q32.3 (191172683: 191029575)     Exons: 30     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran
• OMIM: 600558

Protein Summary

• Protein general information: Q14765  
  • Name: Signal transducer and activator of transcription 4
  • Length: 748  
  • Mass: 85,941
• Sequence:

  MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGRVSKEK
  NLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQRNVEHKVAAI
  KNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDL
  LMNTMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
  LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVKASIDKNVSTLSNRRF
  VLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCHMVTEELHSITFETQICLYGLTIDLETSSLP
  VVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQ
  SSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
  ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHY
  SSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE

• Structural information:
  • Protein Domains: SH2. (569-664)
  • Interpro: IPR008967  IPR000980  IPR036860  IPR001217  IPR029839   IPR035856  IPR036535  IPR013800  IPR015988  IPR013801  IPR012345  IPR013799  
  • Prosite: PS50001
  • CDD: cd10375
  • DIP: 39854
  • STRING: ENSP00000351255
• Other Databases: GeneCards:  STAT4  Malacards:  STAT4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007259	JAK-STAT cascade	TAS	biological process
GO:0000977	RNA polymerase II regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	IEA	molecular function
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007259	JAK-STAT cascade	TAS	biological process
GO:0003700	transcription factor activity, sequence-specific DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007259	JAK-STAT cascade	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04217	Necroptosis
hsa04658	Th1 and Th2 cell differentiation
hsa05200	Pathways in cancer
hsa05321	Inflammatory bowel disease
hsa05161	Hepatitis B

Diseases

Associated diseases	References
Cancer (meningeal)	GAD: 20406964
Antiphospholipid syndrome	GAD: 19644876
Asthma	GAD: 15637551
Autoimmune diseases	GAD: 21383967
Behcet's disease	GAD: 20438790
Chronic ulcerative colitis	GAD: 20176035
Sjogren's syndrome	GAD: 19092842
Rheumatoid arthritis	GAD: 19445664
Scleroderma	GAD: 19605749
Psoriasis	GAD: 19500629
Systemic lupus erythematosus (SLE)	GAD: 21408207
Diabetes	GAD: 18703106
Giant cell arteritis	GAD: 19332627
Male factor infertility	MIK: 11476770
Pulmonary fibrosis	GAD: 19644887
Wegener granulomatosis	GAD: 20049410
Vitiligo	GAD: 21085187
Systemic sclerosis	KEGG: H01492
Male factor infertility	MIK: 11476770
Non obstructive azoospermia	MIK: 24012201
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
11476770	Male factor infertility			9 sperm donors	Male infertility	TYK 2 STAT 1 IFN-alpha IFN-gamma IL-12 TYK 2 STAT 4
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray