• Gene id: 6723

Gene Summary

• Gene Symbol: SRM   Gene   UCSC   Ensembl
• Aliases: PAPT, SPDSY, SPS1, SRML1
• Gene name: spermidine synthase
• Alternate names: spermidine synthase, putrescine aminopropyltransferase, spermidine synthase-1,
• Gene location: 1p36.22 (11060052: 11054588)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The polyamines putrescine, spermine, and spermidine are ubiquitous polycationic mediators of cell growth and differentiation. Spermidine synthase is one of four enzymes in the polyamine-biosynthetic pathway and carries out the final step of spermidine bio
• OMIM: 614925

Protein Summary

• Protein general information: P19623  
  • Name: Spermidine synthase (SPDSY) (EC 2.5.1.16) (Putrescine aminopropyltransferase)
  • Length: 302  
  • Mass: 33825
• Sequence:

  MEPGPDGPAASGPAAIREGWFRETCSLWPGQALSLQVEQLLHHRRSRYQDILVFRSKTYGNVLVLDGVIQCTERD
  EFSYQEMIANLPLCSHPNPRKVLIIGGGDGGVLREVVKHPSVESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLT
  LHVGDGFEFMKQNQDAFDVIITDSSDPMGPAESLFKESYYQLMKTALKEDGVLCCQGECQWLHLDLIKEMRQFCQ
  SLFPVVAYAYCTIPTYPSGQIGFMLCSKNPSTNFQEPVQPLTQQQVAQMQLKYYNSDVHRAAFVLPEFARKALND
  VS

• Structural information:
  • Protein Domains: (18..25-)
    (/note="PABS"-)
  • Interpro: IPR030374  IPR030373  IPR029063  IPR001045  IPR030668   IPR035246  IPR037163  
  • Prosite: PS01330 PS51006
  • PDB: 2O05 2O06 2O07 2O0L 3RW9
  • PDBsum: 2O05 2O06 2O07 2O0L 3RW9
  • STRING: ENSP00000366156
• Other Databases: GeneCards:  SRM  Malacards:  SRM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006596	polyamine biosynthetic process	IBA	biological process
GO:0008295	spermidine biosynthetic process	IBA	biological process
GO:0004766	spermidine synthase activity	IBA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0008295	spermidine biosynthetic process	IDA	biological process
GO:0004766	spermidine synthase activity	IDA	molecular function
GO:0006595	polyamine metabolic process	IEA	biological process
GO:0003824	catalytic activity	IEA	molecular function
GO:0008295	spermidine biosynthetic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0006596	polyamine biosynthetic process	IEA	biological process
GO:0004766	spermidine synthase activity	TAS	molecular function
GO:0004766	spermidine synthase activity	IEA	molecular function
GO:0004766	spermidine synthase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006595	polyamine metabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0008295	spermidine biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00330	Arginine and proline metabolism
hsa00270	Cysteine and methionine metabolism
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq