Search Result
| Gene id | 6694 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | SPP2 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | SPP-24, SPP24 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | secreted phosphoprotein 2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | secreted phosphoprotein 24, secreted phosphoprotein 2, 24kD, secreted phosphoprotein 2, 24kDa, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
2q37.1 (234050666: 234077133) Exons: 10 NC_000002.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a secreted phosphoprotein that is a member of the cystatin superfamily. [provided by RefSeq, Oct 2008] |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 604741 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q13103 Name: Secreted phosphoprotein 24 (Spp 24) (Secreted phosphoprotein 2) Length: 211 Mass: 24338 Tissue specificity: Detected in liver and plasma. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKRVEVLD ENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSSTSESYSSEEMI FGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDFE | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: SPP2  Malacards: SPP2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||