• Gene id: 6693

Gene Summary

• Gene Symbol: SPN   Gene   UCSC   Ensembl
• Aliases: CD43, GALGP, GPL115, LSN
• Gene name: sialophorin
• Alternate names: leukosialin, galactoglycoprotein, leukocyte sialoglycoprotein, sialophorin (gpL115, leukosialin, CD43),
• Gene location: 16p11.2 (29662949: 29670875)     Exons: 3     NC_000016.10
• Gene summary(Entrez): This gene encodes a highly sialylated glycoprotein that functions in antigen-specific activation of T cells, and is found on the surface of thymocytes, T lymphocytes, monocytes, granulocytes, and some B lymphocytes. It contains a mucin-like extracellular
• OMIM: 609562

Protein Summary

• Protein general information: P16150  
  • Name: Leukosialin (GPL115) (Galactoglycoprotein) (GALGP) (Leukocyte sialoglycoprotein) (Sialophorin) (CD antigen CD43) [Cleaved into: CD43 cytoplasmic tail (CD43 ct) (CD43ct)]
  • Length: 400  
  • Mass: 40322
  • Tissue specificity: Cell surface of thymocytes, T-lymphocytes, neutrophils, plasma cells and myelomas.
• Sequence:

  MATLLLLLGVLVVSPDALGSTTAVQTPTSGEPLVSTSEPLSSKMYTTSITSDPKADSTGDQTSALPPSTSINEGS
  PLWTSIGASTGSPLPEPTTYQEVSIKMSSVPQETPHATSHPAVPITANSLGSHTVTGGTITTNSPETSSRTSGAP
  VTTAASSLETSRGTSGPPLTMATVSLETSKGTSGPPVTMATDSLETSTGTTGPPVTMTTGSLEPSSGASGPQVSS
  VKLSTMMSPTTSTNASTVPFRNPDENSRGMLPVAVLVALLAVIVLVALLLLWRRRQKRRTGALVLSRGGKRNGVV
  DAWAGPAQVPEEGAVTVTVGGSGGDKGSGFPDGEGSSRRPTLTTFFGRRKSRQGSLAMEELKSGSGPSLKGEEEP
  LVASEDGAVDAPAPDEPEGGDGAAP

• Structural information:
  • Interpro: IPR038829  
  • STRING: ENSP00000353238
• Other Databases: GeneCards:  SPN  Malacards:  SPN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009986	cell surface	IDA	cellular component
GO:0032609	interferon-gamma production	IDA	biological process
GO:0002296	T-helper 1 cell lineage commitment	IDA	biological process
GO:0005902	microvillus	ISS	cellular component
GO:0001931	uropod	ISS	cellular component
GO:2000406	positive regulation of T cell migration	ISS	biological process
GO:0042130	negative regulation of T cell proliferation	ISS	biological process
GO:2000404	regulation of T cell migration	ISS	biological process
GO:0050901	leukocyte tethering or rolling	ISS	biological process
GO:0032609	interferon-gamma production	IEA	biological process
GO:0050863	regulation of T cell activation	IEA	biological process
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:2000404	regulation of T cell migration	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006935	chemotaxis	TAS	biological process
GO:0006955	immune response	TAS	biological process
GO:0006968	cellular defense response	TAS	biological process
GO:0007162	negative regulation of cell adhesion	TAS	biological process
GO:0007163	establishment or maintenance of cell polarity	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0042742	defense response to bacterium	IDA	biological process
GO:0042535	positive regulation of tumor necrosis factor biosynthetic process	IDA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001931	uropod	IEA	cellular component
GO:0005902	microvillus	IEA	cellular component
GO:0016605	PML body	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0031072	heat shock protein binding	IPI	molecular function
GO:0009986	cell surface	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881