• Gene id: 6674

Gene Summary

• Gene Symbol: SPAG1   Gene   UCSC   Ensembl
• Aliases: CILD28, CT140, HEL-S-268, HSD-3.8, SP75, TPIS
• Gene name: sperm associated antigen 1
• Alternate names: sperm-associated antigen 1, TPR-containing protein involved in spermatogenesis, epididymis secretory protein Li 268, infertility-related sperm protein Spag-1, tetratricopeptide repeat-containing protein,
• Gene location: 8q22.2 (100157868: 100241903)     Exons: 21     NC_000008.11
• Gene summary(Entrez): The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targete
• OMIM: 603395

Protein Summary

• Protein general information: Q07617  
  • Name: Sperm associated antigen 1 (HSD 3.8) (Infertility related sperm protein Spag 1)
  • Length: 926  
  • Mass: 103,639
• Sequence:

  MTTKDYPSLWGFGTTKTFKIPIEHLDFKYIEKCSDVKHLEKILCVLRSGEEGYYPELTEFCEKHLQALAPESRAL
  RKDKPAATAASFTAEEWEKIDGDIKSWVSEIKKEEDKMHFHETETFPAMKDNLPPVRGSNSCLHVGKEKYSKRPT
  KKKTPRDYAEWDKFDVEKECLKIDEDYKEKTVIDKSHLSKIETRIDTAGLTEKEKDFLATREKEKGNEAFNSGDY
  EEAVMYYTRSISALPTVVAYNNRAQAEIKLQNWNSAFQDCEKVLELEPGNVKALLRRATTYKHQNKLREATEDLS
  KVLDVEPDNDLAKKTLSEVERDLKNSEAASETQTKGKRMVIQEIENSEDEEGKSGRKHEDGGGDKKPAEPAGAAR
  AAQPCVMGNIQKKLTGKAEGGKRPARGAPQRGQTPEAGADKRSPRRASAAAAAGGGATGHPGGGQGAENPAGLKS
  QGNELFRSGQFAEAAGKYSAAIALLEPAGSEIADDLSILYSNRAACYLKEGNCSGCIQDCNRALELHPFSMKPLL
  RRAMAYETLEQYGKAYVDYKTVLQIDCGLQLANDSVNRLSRILMELDGPNWREKLSPIPAVPASVPLQAWHPAKE
  MISKQAGDSSSHRQQGITDEKTFKALKEEGNQCVNDKNYKDALSKYSECLKINNKECAIYTNRALCYLKLCQFEE
  AKQDCDQALQLADGNVKAFYRRALAHKGLKNYQKSLIDLNKVILLDPSIIEAKMELEEVTRLLNLKDKTAPFNKE
  KERRKIEIQEVNEGKEEPGRPAGEVSMGCLASEKGGKSSRSPEDPEKLPIAKPNNAYEFGQIINALSTRKDKEAC
  AHLLAITAPKDLPMFLSNKLEGDTFLLLIQSLKNNLIEKDPSLVYQHLLYLSKAERFKMMLTLISKGQKELIEQL
  FEDLSDTPNNHFTLEDIQALKRQYEL

• Structural information:
  • Interpro: IPR025986  IPR013026  IPR011990  IPR001440  IPR019734  
  • Prosite: PS50005 PS50293
  • STRING: ENSP00000251809
• Other Databases: GeneCards:  SPAG1  Malacards:  SPAG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005525	GTP binding	IEA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0007338	single fertilization	IEA	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0070286	axonemal dynein complex assembly	ISS	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0007338	single fertilization	IEA	biological process
GO:0007338	single fertilization	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0070286	axonemal dynein complex assembly	ISS	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0007338	single fertilization	TAS	biological process
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0070286	axonemal dynein complex assembly	ISS	biological process

Diseases

Associated diseases	References
Primary ciliary dyskinesia	KEGG: H00564
Male factor infertility	MIK: 10624499
Male factor infertility	MIK: 10624499
Male infertility	MIK: 10624499
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
10624499	Male-factor infertility			66 (37 fertile men, 29 infertile men)	Male infertility	IASP
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)