• Gene id: 6646

Gene Summary

• Gene Symbol: SOAT1   Gene   UCSC   Ensembl
• Aliases: ACACT, ACAT, ACAT-1, ACAT1, SOAT, STAT
• Gene name: sterol O-acyltransferase 1
• Alternate names: sterol O-acyltransferase 1, acyl-coenzyme A:cholesterol acyltransferase 1, sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1,
• Gene location: 1q25.2 (179293713: 179358679)     Exons: 17     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the acyltransferase family. It is located in the endoplasmic reticulum, and catalyzes the formation of fatty acid-cholesterol esters. This gene has been implicated in the formation of beta-amyloid and atheroscle
• OMIM: 102642

Protein Summary

• Protein general information: P35610  
  • Name: Sterol O acyltransferase 1 (EC 2.3.1.26) (Acyl coenzyme A:cholesterol acyltransferase 1) (ACAT 1) (Cholesterol acyltransferase 1)
  • Length: 550  
  • Mass: 64735
• Sequence:

  MVGEEKMSLRNRLSKSRENPEEDEDQRNPAKESLETPSNGRIDIKQLIAKKIKLTAEAEELKPFFMKEVGSHFDD
  FVTNLIEKSASLDNGGCALTTFSVLEGEKNNHRAKDLRAPPEQGKIFIARRSLLDELLEVDHIRTIYHMFIALLI
  LFILSTLVVDYIDEGRLVLEFSLLSYAFGKFPTVVWTWWIMFLSTFSVPYFLFQHWATGYSKSSHPLIRSLFHGF
  LFMIFQIGVLGFGPTYVVLAYTLPPASRFIIIFEQIRFVMKAHSFVRENVPRVLNSAKEKSSTVPIPTVNQYLYF
  LFAPTLIYRDSYPRNPTVRWGYVAMKFAQVFGCFFYVYYIFERLCAPLFRNIKQEPFSARVLVLCVFNSILPGVL
  ILFLTFFAFLHCWLNAFAEMLRFGDRMFYKDWWNSTSYSNYYRTWNVVVHDWLYYYAYKDFLWFFSKRFKSAAML
  AVFAVSAVVHEYALAVCLSFFYPVLFVLFMFFGMAFNFIVNDSRKKPIWNVLMWTSLFLGNGVLLCFYSQEWYAR
  QHCPLKNPTFLDYVRPRSWTCRYVF

• Structural information:
  • Interpro: IPR004299  IPR014371  IPR030687  
  • STRING: ENSP00000356591
• Other Databases: GeneCards:  SOAT1  Malacards:  SOAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033344	cholesterol efflux	IBA	biological process
GO:0008374	O-acyltransferase activity	IBA	molecular function
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0000062	fatty-acyl-CoA binding	IBA	molecular function
GO:0034736	cholesterol O-acyltransferase activity	IBA	molecular function
GO:0034435	cholesterol esterification	IBA	biological process
GO:0015485	cholesterol binding	IBA	molecular function
GO:0008203	cholesterol metabolic process	IBA	biological process
GO:0004772	sterol O-acyltransferase activity	IMP	molecular function
GO:0008374	O-acyltransferase activity	IEA	molecular function
GO:0042632	cholesterol homeostasis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0034435	cholesterol esterification	IEA	biological process
GO:0034736	cholesterol O-acyltransferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008202	steroid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0034736	cholesterol O-acyltransferase activity	IEA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0008203	cholesterol metabolic process	IDA	biological process
GO:0004772	sterol O-acyltransferase activity	IDA	molecular function
GO:0034383	low-density lipoprotein particle clearance	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004772	sterol O-acyltransferase activity	IEA	molecular function
GO:0008203	cholesterol metabolic process	IEA	biological process
GO:0000062	fatty-acyl-CoA binding	IDA	molecular function
GO:0015485	cholesterol binding	IDA	molecular function
GO:0034736	cholesterol O-acyltransferase activity	IDA	molecular function
GO:0004772	sterol O-acyltransferase activity	IMP	molecular function
GO:0034736	cholesterol O-acyltransferase activity	IMP	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0010878	cholesterol storage	IMP	biological process
GO:0033344	cholesterol efflux	IMP	biological process
GO:0042632	cholesterol homeostasis	TAS	biological process
GO:0008203	cholesterol metabolic process	IDA	biological process
GO:0010742	macrophage derived foam cell differentiation	IC	biological process
GO:0034435	cholesterol esterification	IDA	biological process
GO:0008203	cholesterol metabolic process	IMP	biological process
GO:0010742	macrophage derived foam cell differentiation	NAS	biological process
GO:0010742	macrophage derived foam cell differentiation	IMP	biological process
GO:0034379	very-low-density lipoprotein particle assembly	IMP	biological process
GO:0034435	cholesterol esterification	IMP	biological process
GO:0042986	positive regulation of amyloid precursor protein biosynthetic process	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04979	Cholesterol metabolism
hsa00100	Steroid biosynthesis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)