|
Gene id |
6613 |
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed |
Gene Summary
|
|
Gene Symbol |
SUMO2 Gene UCSC Ensembl |
|
Aliases |
HSMT3, SMT3B, SMT3H2, SUMO3, Smt3A |
|
Gene name |
small ubiquitin like modifier 2 |
|
Alternate names |
small ubiquitin-related modifier 2, SMT3 homolog 2, SMT3 suppressor of mif two 3 homolog 2, sentrin 2, ubiquitin-like protein SMT3A, ubiquitin-like protein SMT3B, |
|
Gene location |
17q25.1 (75182958: 75165585) Exons: 4 NC_000017.11
|
|
Gene summary(Entrez) |
This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unl
|
|
OMIM |
603042 |
Protein Summary
|
| Protein general information
| P61956
Name: Small ubiquitin related modifier 2 (SUMO 2) (HSMT3) (SMT3 homolog 2) (SUMO 3) (Sentrin 2) (Ubiquitin like protein SMT3B) (Smt3B)
Length: 95 Mass: 10871
Tissue specificity: Broadly expressed. {ECO
|
| Sequence |
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQ LEMEDEDTIDVFQQQTGGVY
|
| Structural information |
|
| Other Databases |
GeneCards: SUMO2  Malacards: SUMO2 |
|
|
|
|
| Pathway id | Pathway name |
| hsa03013 | RNA transport | | hsa05418 | Fluid shear stress and atherosclerosis | |
|
| Associated diseases |
References |
| Cryptorchidism | MIK: 28606200 |
| Teratozoospermia | MIK: 17327269 |
|
|
| PMID |
Condition |
Mutation |
Ethnicity |
Population details |
Infertility_type |
Associated_genes |
Abstract |
| 17327269 |
Teratozoos permia
|
|
|
13 (5 controls, 8 cases)
|
Male infertility |
GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
|
Show abstract |
| 28606200 |
Cryptorchi dism
|
|
|
Monozgotic twin s (1 control, I cwith cryptorc hidism)
|
Male infertility |
MeDIP-Seq
|
Show abstract |
|