• Gene id: 65997

Gene Summary

• Gene Symbol: RASL11B   Gene   UCSC   Ensembl
• Gene name: RAS like family 11 member B
• Alternate names: ras-like protein family member 11B,
• Gene location: 4q12 (52862316: 52866834)     Exons: 4     NC_000004.12
• Gene summary(Entrez): RASL11B is a member of the small GTPase protein family with a high degree of similarity to RAS (see HRAS, MIM 190020) proteins.[supplied by OMIM, Nov 2008]
• OMIM: 612404

Protein Summary

• Protein general information: Q9BPW5  
  • Name: Ras like protein family member 11B
  • Length: 248  
  • Mass: 27508
  • Tissue specificity: Widely expressed with highest levels in placenta and primary macrophages. {ECO
• Sequence:

  MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVQ
  IEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLHLGTRLPVVVV
  ANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSSTPEKRRTSLIPRPKSP
  NMQDLKRRFKQALSAKVRTVTSV

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • STRING: ENSP00000248706
• Other Databases: GeneCards:  RASL11B  Malacards:  RASL11B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030512	negative regulation of transforming growth factor beta receptor signaling pathway	IEA	biological process
GO:0005160	transforming growth factor beta receptor binding	IEA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)